KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222068
Entry
112222068         CDS       T05605                                 

Definition
(RefSeq) myosin light chain kinase 2, skeletal/cardiac muscle-like isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112222068
   04020 Calcium signaling pathway
    112222068
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112222068
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112222068
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112222068
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112222068
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     112222068
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   112222068
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like
Other DBs
NCBI-GeneID: 112222068
NCBI-ProteinID: XP_024240414
LinkDB
Position
22
AA seq 763 aa
MGSVRCTPPVPLPTNLPVLEAKVDDLSHKLDELLSRQIGSCSICSTCSLHSGQPEATERQ
LVAQSRLLENFERKIGEMQRTLEALAKGLAQSNPHTCQEAAPAPPIEPSPRTVYLPAKTS
LVTSKDEIPDQLETNRQQDKTQHTPTTPAKKETDAKKTLTRLAVAVFPSMAHTQKILTQT
RTTVTKNQALTSIEESLRTASLPVSDSLSTEKAETLNQFETNRHQETKQQTPIASAKKGV
SAGMGAEQRDCVGEQWIGGNQQGVRGQPMAADSHRQSETKRGWMREVPAVAVVPSMANTP
RTEMRNTVAENQAAAPSSPAPAPKKQSGSVVLMPTVESSSLRQVHSCPESLQRLQSSRPK
PQSVCPARRPAVGKTCSVLGGASPVAASGIQIIVVPTTAERTWPKSPTKTFHKVIDDVPP
QPAPFLHRCVSLRSNPPSDTFIIHTREVLGSGRFGKVHKCTEKSSGLKLAAKIINTRTAK
EKERANNEVQAMNQLSHPNILQLYEAFEAKHQLVLILEYVEGGELFDRIVDESAPLTEVD
AMVFVKQICEGVSYMHQMYVLHLDLKPENILCVNRTGHQVKIIDFGLARRYRPREKLRVN
FGTPEFLAPEVVNFDFVSFPTDMWTLGVVTYMLLSGLSPFLGDDESQTLNNVLSANCSFE
DEAFEHISAEAKDFISHLLVKERGERMSALQCLRHPWLNNIAEKAKGSNIVLKSQVLLKK
YLAKKLWKKNYIAIAAANRFKKISSGGELTSLDTETDTIPIAT
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgggttccgtgcggtgtacgccacctgtcccactccccacaaacctacctgtcctagag
gccaaagtagatgacttgagtcacaagttagatgagctcctctccagacaaataggttcc
tgttccatctgctccacctgcagtctgcacagcggccagccagaggcaacagaaaggcag
cttgtggcccagtccaggctgctagagaactttgagaggaagatcggtgagatgcagagg
accttagaggccctggccaaaggtctggcgcaaagtaacccccacacctgccaggaagct
gccccagccccacccattgagccatcacctagaacagtatatctgccagccaagacctca
ctagtcacttctaaggatgagatcccggatcagttggagacaaacagacagcaggataag
acacaacacactcctaccaccccagcaaagaaagagacggatgcaaagaaaacattgaca
cggctggcagtagcagttttcccatcaatggcgcacactcaaaagattttgactcagaca
aggaccacagtgacgaagaaccaagcgttgacatccatcgaggaatcacttaggacagca
tctctgccagtcagtgattcattaagcacggaaaaggctgagaccctgaatcagtttgag
acgaacagacaccaggaaacaaagcaacagactcctatcgcttctgcaaagaaaggggtg
tctgctggtatgggagcagagcaaagagactgtgttggagagcagtggattggagggaac
cagcagggggtcagaggtcaaccaatggcagcagattcccacagacagagtgaaactaaa
aggggttggatgagagaggttccagctgtagcggttgtcccatcaatggcgaacactcca
aggactgagatgaggaacacagtggcggagaaccaagcagctgctccatcaagtcccgcc
cccgcaccaaaaaagcagtctgggtcggttgtccttatgccaactgtggaaagctcctcc
ctcagacaagtgcacagctgtccagagtccttgcagaggctccagagttcaaggcccaag
ccccagtctgtctgccctgcccgtagacctgctgttgggaagacctgcagtgttttggga
ggggctagtccagttgcagccagtggaatacagatcatagtagtccctactacagcagaa
aggacctggcccaagtcccctaccaaaactttccataaggtcatagatgatgttcccccg
cagccagctcctttccttcaccgctgtgtgtctttgcgatccaaccccccatctgacacc
ttcatcatccacaccagagaggtgctggggagcggacgctttggcaaggtgcacaaatgc
actgaaaaatcctctggactaaagcttgcagctaagataatcaacacacgaactgctaaa
gaaaaggaaagggcaaataacgaggtgcaggcaatgaaccagctgagtcatcccaacatc
ctccagctctacgaggcctttgaggccaagcaccagctggtgttaattctggaatatgtt
gagggcggggagctgtttgacaggattgtggatgagagcgcaccactgaccgaggtggac
gccatggtgtttgtcaagcagatctgtgaaggggtcagctacatgcatcagatgtacgtc
ctccacctcgacctgaaaccggagaatatcctttgtgtgaatcgaactggccatcaggtg
aagattatcgactttgggctggcaagaagatacaggccgcgggagaagctcagagtcaat
tttggaacccctgaatttctggccccagaggtggtcaactttgattttgtgtcctttccc
acagacatgtggaccttaggggttgtcacttatatgcttctaagtggcctttcacccttc
ctgggtgatgatgagagccagaccctcaacaacgtcctctctgccaactgttcttttgag
gatgaggcctttgagcacatctcagcagaggccaaggactttatctcccaccttctggtc
aaggagaggggagagcgaatgagtgctttacagtgtctaagacatccgtggctcaacaac
attgcagagaaggccaaaggcagcaatatagtactgaagtcccaggtcctgctgaagaaa
tacctggccaagaaactatggaagaaaaactacattgcgatagcagcagccaacagattc
aagaagatcagcagcggtggggaactgacctctctggatacggagacggatacaatacct
atagcaacgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225163
Entry
112225163         CDS       T05605                                 

Definition
(RefSeq) myosin light chain kinase, smooth muscle-like
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112225163
   04020 Calcium signaling pathway
    112225163
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112225163
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112225163
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112225163
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112225163
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     112225163
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   112225163
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 Pkinase ig V-set PK_Tyr_Ser-Thr C2-set_2 fn3 Kinase-like Invasin_D3 Kdo
Other DBs
NCBI-GeneID: 112225163
NCBI-ProteinID: XP_024244611
LinkDB
Position
26
AA seq 1830 aa
MGDVQLVTTTRISKTSLTVGRGSPSPESPTFTLPPRNARVSPGETARLDGKVRGHPEPQV
MWSRNGKAVIAGDRFAMEQSSRGTFSLVVHGIQEEDAGRYTCEAVNDAGSRQVTVEITVE
GNTGKKYSLPSSSRTGGRFGVPAVESRPSIWGESPPKFVTKPSRIFVRMGQTGKFSAKIT
GRPQPLVTWLKGDEELHASPHFNMFEKSGIHFLEIRDVCVDDAGMYTCSVANSAGKATAT
AELIVQGSGSDSGILSPSALVAPVPKTTDSREVKPTSNGLLADQRSPAKTGDGTETRLTT
LTRETKDSTEIKTPAWKTSVASPKTTVVTSHKPPADLPDKAPRKPGVSPPKTASSTTLQH
HLGGQGAARTSPHPQSRAPERDTRDQLKPPPKGVPEPSPEPTRETRRQTRESRSERAAVT
AGAQPKFDSVPQSQDATEGTPVTFKCQVSGSPVSGLSWVKDGLPLRPRAGLTFQQDGNTH
IVTVTNVQKRDSGTYGCTMTTNTGKVSSTWILGVKNPRQEGKPPAFSTVLKGCSVSEGQD
FLLQCSVDGKPRPDLSWLLNDKPMPYARSSFENGLAQLIVQGALPEDEGQYTCVAENIHG
RAVCTAKVIIKAKKSAKRSDPPNAVDTKKPSAPVFLRGLKDLKVMDGSQVIMTVEVTGNP
HPEIVWLHNGKEIQESEDFHFERKGNQCSLFIQEVFPEDTGKYTCEAWNKVGEVRTEVSL
TVQEPQDGVQPWFITKLKPTTAYLGQNVLLSCAIAGDPFPQWSWMKQGQVVTTDLDYEIL
QKEDVVSLLIRRVRSHHAGDYEISLRNKVGDCSCVATLVVSDGAVVSSGEHQTPEPCQRV
GGVDGTVRGRAPPSSSSIPQQGSEEPSTARGLLKRRVETKEHREDQIRLQEAEQRDFRTV
LGRKVTTKSVSEEDLKEITAEQMDFRGQLQPRGGKPKTLSEDERKVNAPTQVDFRDVLGK
KGGTTSPKPGTAPTEKGEPTDFRSVLANKKNQTSLEKNGESPAPEAATPKAPAATEKEKN
AINCVAGGIIDESNNIGKEPLFSQKLSDMSVVDGACLRLHCQVTCDPPATITWTLDGKVI
KPSKFIKLSNEGGQCSLTIDKALPEDEGQYKCRVENSAGKAECSCMVLVDDPTDTNSTAA
DKKSKKPSIPTSESEARIKKPNTKTPPKQAIPPQIVQFPDDMKILAGEKVEILCKFGGAP
PIKCTWLKFRKPIQEVKGDLTIETTESNSKLTIADSQQEHCGCYTVELRNNYGVRQAALN
LTVVDKPDPPARVPAASDIRRSTLTLSWYGPTYDGGSAVQSYNLEIWNSVDNEWKDLVSC
NSTFYNVHNLLGQRQYKFRVRAVNIYGIGEPSAESEPVTMLEEDVEEKEEVEDDEDKEPD
YRDVTVRTDVKVKDLYDVEERLGTGKFGQVFKLLEKATKKHWAGKFIKAYSAKEKDNVRQ
EIAIMNSLHHPKLVQCIDAFEGKSDIVMVLEMISGGELFERIIDEDFELTEREVIRYMLQ
IVDGVHYIHKQGIVHLDLKPENIMCVNKTGNTIKLIDFGLARRLENSGTLKVLFGTPEFV
APEVINYEAISYPTDMWSIGVICYILVSGLSPFMGDNDNETLSNVTSATWDFEDDAFDEI
SDHAKDFITMLLKKDMKARLTCDRCYEHPWLKQDTGKMEAKKLSKERMKKYILRRKWQKT
GHAVRAIGRLSSMAMLAGVSAKKGSPTEEDNQFLEFLESEEGTQVKPTFSSMIKDVEVVE
GSAARFDCKIEGYPDPEVVWYKDEQPIKETRHYQIDYDEEGNCSLVISEVNGDDDAKYTV
KAVNSLGEATCTAELLVEVMAEEEEEEEEE
NT seq 5493 nt   +upstreamnt  +downstreamnt
atgggggatgtgcagcttgtgactacaacacggatctccaagaccagcttgacagtaggc
cgaggttctccaagtccggagtctccaaccttcactctcccacctcgcaatgcccgggtc
agcccaggagagaccgcacgccttgatgggaaggtgagaggacaccctgagccccaggtc
atgtggtccaggaatgggaaagcggtgatagctggagatcgcttcgccatggaacaaagt
agccgtggaaccttcagcctggtggtccacggtatccaggaggaggatgcgggacgttac
acgtgtgaggcagtcaacgatgccggaagtcgccaggtcacagtggagatcactgtagaa
gggaacacggggaagaaatacagcctcccttcctccagtagaacaggcgggcggtttgga
gttccagcggtggagagcaggcccagtatttggggggagagcccccccaagtttgtgaca
aaaccctcacgtatttttgtcagaatgggacagactggcaaattctcggccaaaatcaca
ggacgtccacagcccttggttacctggctcaaaggagatgaggagctccatgcttctccc
cacttcaacatgtttgagaagtccggaatccacttcctggagatccgagatgtgtgtgta
gacgatgcaggaatgtacacctgctctgtggccaacagtgctgggaaggccacggctaca
gcggagttgatcgttcagggttcaggcagtgactcgggcatcctaagtccctcggctctg
gtagcacctgtcccaaagacaactgactcacgtgaagtcaagcccacaagtaatggcctg
ctcgcagaccaacgatcccctgccaaaacaggagacgggactgagaccaggctcaccact
ctcaccagggagaccaaagacagcacagagatcaaaactccagcatggaagaccagcgta
gcatctcccaagaccaccgtcgtgacttctcacaagcctcctgcagacctgccagacaaa
gcccctagaaagcctggtgtctctccccccaagactgccagctccacaaccctgcagcac
catctgggaggccagggcgctgcaaggaccagccctcacccccaaagcagagcccctgag
agggatacaagagatcagttgaaaccccccccaaagggagtcccagagccgtctccagag
cccaccagagagaccagaaggcagaccagagagagccggtcagagagggcagcagtgact
gcaggagctcaacccaaatttgactctgtacctcagagccaggatgctacggaggggacc
ccagtcacattcaaatgccaagtctcaggttctcctgtgtctggcctgagctgggttaaa
gatggcctccctttgagacccagagcagggctgaccttccagcaagatggcaacacacac
atcgtcactgtgaccaacgtccagaagagggacagtggaacttatggttgcaccatgacc
accaacactgggaaggtttcttctacttggatcctcggtgttaagaacccacggcaggag
ggcaagcccccagcattcagcacagtcctgaagggatgttcagtgagtgagggccaggac
ttccttctgcagtgctcagtggatggaaagcctcgacctgacctctcctggctcctaaac
gacaagcccatgccatacgcccgctcttcctttgagaatggcctggcccaactcatagtc
cagggtgccctgccagaggacgagggccagtatacttgtgttgctgagaacatccatggg
agagccgtgtgcactgccaaagtcatcatcaaagctaaaaaaagtgccaagaggtcggac
cctccaaatgcagtcgacaccaagaagccatcggcccctgtatttctcagaggtctgaag
gatctaaaagttatggacggtagccaagtcatcatgaccgtggaggtgacagggaatcct
catccagagattgtgtggctccacaatgggaaggagatccaggagtctgaggacttccac
tttgagcggaaggggaaccaatgcagtctgttcatccaggaagtcttccctgaggacact
gggaagtacacctgtgaggcgtggaacaaagtaggggaggttcgcacagaggtctcactc
actgtacaagagccccaggacggggtccagccctggttcatcacaaagctcaagcccacc
accgcctacctgggccagaatgtcctgctgtcctgtgccatcgctggggatcccttccct
cagtggagctggatgaagcagggccaggtggtgaccactgacctggactatgagatactg
cagaaggaggatgtggtgtccctgctcattagacgagtccggtcccaccacgccggggac
tacgagatcagcctgaggaacaaagtgggtgactgcagttgtgttgccactctggtggtc
agtgatggtgcagtggtgtccagtggagagcaccaaacccctgagccttgtcagcgtgtg
ggaggagtggacgggacagtgcgaggcagagcaccaccaagcagcagctccattccgcag
caggggtcagaagagccaagcacagcccggggactcctgaagaggcgcgtggagaccaag
gagcaccgtgaggaccagatccgcctgcaggaggctgagcagcgcgacttccgcacggtg
ctgggcaggaaagtcaccaccaagagcgtctccgaggaggacctgaaggagatcacggcg
gaacagatggacttcaggggccagctccagcccagagggggcaagcccaagacactgtct
gaagatgagaggaaggtcaacgctcccacgcaggtggactttagagatgtgctggggaaa
aaagggggcaccacctccccgaaaccaggtaccgctcctactgagaaaggagagcctaca
gatttcagatcggttctggccaacaagaagaatcagacgagcttggagaagaatggggag
agccctgctccagaagcagcaacaccgaaagcccctgctgccactgagaaggagaagaac
gctatcaactgcgtggcaggtgggattattgatgagagtaacaacattggaaaggagcct
ttgttcagtcagaagctgagtgatatgagcgtggtggacggggcttgcctgaggctacat
tgccaagtgacctgtgaccccccagcaactattacctggactctagacgggaaggtcatc
aagccctccaagttcatcaagctgtccaacgaaggaggccagtgctccctgaccatcgac
aaggccctgcccgaggacgagggccagtacaagtgccgggtggagaactcggccggtaaa
gcagagtgttcctgcatggtgctggtggatgatcctacagacacaaactcgacagcagct
gacaagaagagcaagaagccatccatccctacctccgagagtgaggcaaggataaagaaa
ccgaatacaaagactcctcccaaacaggctataccacctcagattgttcagttcccagac
gacatgaagatcctggcaggagagaaggtggaaattctctgtaagtttggaggagctcct
ccaatcaaatgcacctggctcaagttccgcaaaccaatccaagaggtcaaaggtgattta
accattgaaaccactgagtccaacagtaaactgaccatcgctgacagccagcaggagcac
tgtggctgctacaccgtagagttgcgaaacaactacggcgtgagacaggctgctctcaac
ctcaccgttgttgacaaacctgatccccctgcccgtgttccagctgcctcagacatccgc
cgctccaccctcacgctgtcatggtacggccccacctacgacgggggcagcgcggtccag
tcttacaacctagagatatggaattctgtggacaacgagtggaaggatctggtctcctgc
aacagcaccttctataatgttcacaatctgctgggtcaacgccagtacaagttcagggtg
cgggctgtcaatatctacggtatcggcgagcccagtgcagagtctgagcctgtcacaatg
ctagaggaggatgtagaggaaaaggaggaggttgaggatgatgaagacaaagagccagac
tacagagacgtgaccgtgagaacagatgttaaagtcaaggatctgtacgatgtggaagag
cgcctcggaacggggaaattcggacaagtatttaaacttttggagaaggcaacgaagaag
cattgggctggaaagtttatcaaagcctactctgccaaagagaaagataatgtgagacaa
gagattgctataatgaactccctccatcaccccaaacttgtccagtgcattgatgccttc
gagggcaagtcggacatcgtcatggttttggaaatgatctctggtggggaactgtttgag
cgtatcatcgatgaagactttgagctgacggagagagaggtcatcaggtacatgctgcaa
atcgtggatggggtccattacatccacaagcagggcatagtccatctggacctgaagcct
gagaatatcatgtgtgtcaacaagactgggaacaccatcaaactcatcgactttggcctc
gcacgcagactagaaaactctggaacattgaaagttctttttggaacccctgagtttgtg
gccccagaagtgatcaactatgaagcaatcagttacccaacagacatgtggagtatagga
gtcatctgctacattctcgtgagtggcctgtccccgttcatgggggacaacgacaacgag
accctgtccaacgtgacctcggccacctgggactttgaagacgacgccttcgatgagatc
tcagaccacgccaaagacttcatcaccatgctgctgaagaaagatatgaaggccagacta
acatgtgatcgctgctatgaacacccatggctaaaacaagacactggcaaaatggaggcc
aagaagctgtccaaggaaaggatgaagaaatacatcctgagaaggaaatggcagaaaacg
ggacatgcagtgcgggccataggaagactgtcgtccatggcgatgttggcgggcgtcagt
gccaagaagggctcccctaccgaagaggacaaccagttccttgagttcctggagtctgag
gagggaacccaggtcaagcccaccttcagctccatgataaaggatgttgaggtggtagag
gggagcgcagccagatttgactgcaagattgagggctaccctgatccagaggtggtgtgg
tacaaagacgaacagcccatcaaggagacgcgccactaccagattgattacgacgaagag
ggcaactgcagcctggtgatctctgaggtgaacggtgacgacgatgccaaatacaccgtc
aaggctgtcaacagtctgggcgaggccacgtgcacagccgaactcctggtggaggtgatg
gcggaggaggaggaggaggaagaagaggaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225996
Entry
112225996         CDS       T05605                                 

Definition
(RefSeq) myosin light chain kinase, smooth muscle-like isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112225996
   04020 Calcium signaling pathway
    112225996
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112225996
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112225996
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112225996
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112225996
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     112225996
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   112225996
SSDB
Motif
Pfam: Pkinase I-set PK_Tyr_Ser-Thr Ig_3 Ig_2 ig V-set fn3 C1-set C2-set_2 Kdo Kinase-like APH
Other DBs
NCBI-GeneID: 112225996
NCBI-ProteinID: XP_024245939
LinkDB
Position
27
AA seq 885 aa
MSSDSSSKKRYVSTLRMYIGPTNTSPGQGKNILATSITSATATRTGVDTASSTGSSCPTP
THLRGLDPPLFTEPLEDCSADEGSDITLRGVITGSQPISVSWLHNGEAVFFGEPLFDGSE
TKLVVRECLPEDAGAYTCVAENRAGKTSSSAAVCVRDFETICGVLNATSHTSPPLNNSIM
ENRGSKLLLSSNNDSVFRQPSSPRSSNTPSPGGPRKVSTEVTPKKRASSGTASLQFKDPP
SHIEARLGETARLTCVFSGSSPVVSCWIRNKEPVVDGSELWVESSDQSSTLVIAEPGPEH
SGRYTVVVRDRKSSAQHTLALSVIERPQSPASSPVVSLLSVSPLCLVLSWSGPCYDGGSA
VLGYVVEVKRKGPTESGDWSELTAHCKSTSYKVRAGLEPQGEYYFRVRAYNVVGVSEPSE
ESQLIKMEQIAEPQEEESPRTYEDVTIDSTHKVTDHYNVLEKLGVGKFGQVFKLTHKETG
RVCAGKFYKGRRAKEREAARKEIELMKYLHHPKLVQCLGAYDLKPEMVMVMEFIAGGELF
ERIVDDSFVHTEPASVHYMQQIVEGMGYMHQQNIIHLDLKPENIVCVDHTGTRIKIIDFG
LASKLDPSTPLKVMHGTPEFVAPEVIGYEPVSLATDMWSIGVICYILLSGESPFQGNSEA
ETLALVTGAQWEFDEESFEEITDQAKDFISSLLNKEPRRRISCDEALVHSWIAEPISADP
STTKCLSKEKMKRYLAKQKWKKTGKALLALKRMALLSKADGPGSPTTPAEDSPLSPEAEQ
ALQSLEVKLQGVPQFSLTPTDQTVSQGSTARLSCHLTGYPDPEVVWLRGEEPLEESSRVQ
IEYEEDGLCTLVLAQVGPEDSDVYTCRASNDQGKALCSAKLIVKE
NT seq 2658 nt   +upstreamnt  +downstreamnt
atgagcagtgacagcagctccaagaagcgctatgtatcaaccctcaggatgtacatcggc
cccaccaacacttcccctgggcagggaaaaaacatcctggcaaccagtatcacttctgct
actgccactaggactggggtagacacagcctctagtacagggagcagctgccccacacct
acccatctcagaggtctggatccacccctgttcacagagccattggaggactgctcggcg
gatgaaggaagtgacatcacactccgaggggttatcacaggaagtcagccaatcagtgtg
tcctggctgcacaatggtgaagcagtgttttttggggagcccctcttcgatggcagtgag
acgaagctggtggtgagggaatgcctacctgaggacgcgggcgcctacacctgtgtggca
gagaaccgagcgggcaagacctccagcagcgcagctgtgtgtgtgagagacttcgagact
atctgcggtgtcctgaacgcaacttcacacacttcccctcccctcaacaacagcattatg
gagaacagaggctcaaagttactactgtcatccaacaatgacagtgtgttcagacaaccc
agctccccaagaagctctaacaccccgagcccaggaggaccccgaaaagtctccacagaa
gtcacgccaaagaagagagccagctcggggacagcctcgttgcagtttaaggatccccca
tcccacattgaggcacggctaggagagacagcccgtctgacgtgtgtgttcagtggaagt
tcccctgtggtgtcctgctggatacgaaataaagaaccggttgtagatgggtctgagttg
tgggtagagagcagtgatcagagcagtacgttggtgatagcagagccaggacctgagcac
tcaggacgctacaccgttgtagtacgagaccgcaagagctcggcgcagcacaccctcgct
ctttctgtcatagagcggccccagtccccagcctccagccctgtggtgtctctcctctct
gtctctcctctctgtttggtcctgtcctggtctgggccctgctacgacggaggcagtgcc
gtcctgggctacgtggtggaggtgaagaggaaaggccccactgagtctggagactggagt
gagctcacagcccattgcaagagtacttcttacaaggtgcgcgccgggcttgagcctcag
ggggagtactacttccgggtgagggcctacaacgtggtgggggtgagcgagcccagtgag
gagtctcagcttatcaagatggagcagatagctgagccacaagaggaggagtctcctcgg
acatatgaggacgtcaccatcgactccacccacaaggtcactgatcactacaatgtactg
gagaaactgggagtggggaagtttggccaggtgttcaaactgactcacaaggagacgggt
cgtgtgtgtgccggaaagttctacaagggccggcgggctaaggagagggaggcggcccgt
aaagagatagagctgatgaaatacctgcaccaccccaaactggtccagtgtctgggggcc
tatgatctcaagccagaratggtcatggtcatggagttcattgccggaggtgagctgttt
gagcgtatagtggacgacagctttgtgcacacagagccggccagtgtgcactacatgcag
cagatcgtggaggggatgggctacatgcaccagcagaacatcatccacctggacctgaag
cctgaaaacatagtgtgtgttgaccacactggcacgcgcatcaagatcattgactttggc
ctggccagcaagctggacccctccactcccctgaaggtgatgcacgggacaccagagttt
gtggctccagaggtgattggctatgagcctgttagcttagctacagacatgtggagcatt
ggagtcatctgctatatattactgagtggcgagtctcccttccagggtaacagtgaagca
gagaccctggccttggtgactggtgctcagtgggagtttgacgaggagagctttgaagag
atcactgaccaggccaaagacttcatcagctccctgctcaacaaggaaccaaggcgcagg
atatcctgtgacgaggctctggtccactcctggatagctgagcccatctcggcagacccc
agcaccaccaagtgtctctccaaggagaagatgaagaggtacctcgccaagcagaagtgg
aagaaaacagggaaagccctgctggcgctgaagaggatggctcttctgtctaaagccgat
ggacctggctctcccaccacccctgcagaagacagccccctgagtcctgaggcagagcag
gccttgcagtctctagaggtcaaactccagggggtgccccagttctccctgaccccaacg
gaccagactgtctcccagggctccaccgcccgcctctcctgtcacctcacagggtatcct
gacccagaggtggtgtggttgaggggggaggagcctctggaggagtcatcccgggtgcag
atagagtatgaagaggatgggctctgcaccctggtcctggcccaggtcgggccagaggac
tctgatgtttacacctgtcgggcctccaacgaccaggggaaggcactgtgttcagccaaa
ctcatagtaaaggaatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226830
Entry
112226830         CDS       T05605                                 

Definition
(RefSeq) myosin light chain kinase 3-like
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112226830
   04020 Calcium signaling pathway
    112226830
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112226830
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112226830
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112226830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112226830
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     112226830
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   112226830
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo DUF1664 HSBP1 Kinase-like
Other DBs
NCBI-GeneID: 112226830
NCBI-ProteinID: XP_024247192
LinkDB
Position
28
AA seq 837 aa
MSSNVVNYNSTSRKPSTMDNVTDCNGAGLDLIQNRIESLNSKMDKLINIQEKVLNRLDGM
SQDIDSIERDMETLKVDKEEIHIPVGARTLPPALAQTQGTGMGGEVREMCQEMSSIMTVL
DQRSEKQAEKLDGMEKLVLSIHQVIRFIGETMKSPRVMEMMFMGPAAHKASKSKDLKMAI
KRQSSAEKSKSSVTKKTDKPKDHKKKDGKEKSGLSPKGLKAQKKKKLPDTADTISLRKQV
LLLEEVQKLNRENAERSSSSSSGHQQQHLTPDGFLDLEAGSGGASEGSLSPNLLDLILEG
PKAPVTEEESLSEEEAAGDGLKVEERKEEEVVKKEKEDHLVNESKEEERKEELLKTTEKP
EEDGRLEEKKGEKEKEGDTTLSKGPSEAVDMSVKDIPSLPTSSEAPGDTNSIPESCEDHN
KSDSSLSLEAAKQDQVEEGSTGSKRRVMEEDLGVEDHKKSRVEEGEEEEREGERKEEEEA
ERPEDEGWGVFKADGVDIRVEGKKRLGKDQATEVKQSTGETFFIDKSPPPPAPFNHRIVS
AKPNQISNFYTINRVEILGGGRFGQVHKCMENSSGLTLASKIIKARSQKEKEVVKNEIMV
MNQLDHANLIQLYAAYESRNDIILVLEYVDGGELFDRIIDENYTLMELDTVMFIRQICEG
LQHMHKMYILHLDLKPENILCVSRVTNKIKIIDFGLARKYMPREKLRVNFGTPEFLAPEV
VNYDFVSFNTDMWSLGVITYMLLSGLCPFLGDNNPETLNNILACQWNFDEEEFTDISEEA
KDFISKLLIVNKSWRIGASEALRHPWLSDPVLHHRLHEKKNMCHCSRRSSCVPITES
NT seq 2514 nt   +upstreamnt  +downstreamnt
atgagttccaatgtagtgaactataactcaacctcaagaaagccaagcacgatggataac
gtaaccgattgcaatggtgccggcttggacctcattcagaatcgcattgagtctctgaac
agtaagatggacaaactcatcaacatccaggagaaggtcctcaaccggctggatggaatg
tcccaggacattgacagtatagagagggacatggaaacactgaaggtggataaggaagag
atccatatccctgtcggagcccgaactctaccaccggccctggctcaaacccagggcacg
ggcatggggggcgaggtgagagagatgtgtcaggagatgagctccatcatgacagtgctg
gaccagcgctcggagaagcaggctgagaagctggacgggatggaaaagctggtcctcagc
atccatcaggtcatcagattcattggggagacgatgaagagcccccgggttatggagatg
atgtttatgggtccggcagcacacaaggcctccaagtcaaaagacctcaagatggctatt
aagaggcaatcgtccgcagaaaagagcaagagctcagttactaagaagaccgacaagcca
aaagatcacaagaagaaggatgggaaggagaagtcgggtctgagcccgaagggtctgaaa
gcacagaaaaagaagaagctcccagacacagcagatacgatctcccttaggaagcaggtg
ttgctactagaggaggttcagaagctcaacagggagaatgcagagagatcatcatcatca
tcatcaggtcaccagcagcagcacctcacccctgatggcttcctggacctggaggctggg
tctggaggggcctcagagggttccctcagcccaaacctgctggaccttatcctcgagggc
cccaaggcccctgtgactgaagaggagtcattgtctgaggaggaggctgccggagatgga
ctaaaagtagaagagaggaaggaggaggaggttgtaaaaaaggagaaggaagaccacctt
gttaatgaatctaaggaagaggagagaaaggaggagttgttgaaaaccacagagaagccc
gaggaggatggaagactagaggaaaaaaagggggagaaggagaaagagggggacactaca
ctctctaaaggcccatcggaagctgttgatatgtcggtaaaggatatcccttctctccca
acctcctctgaggctccaggagacaccaactccattcccgagagctgtgaagaccacaac
aaaagtgattcctctctgtctctggaggcagcaaaacaggaccaggtggaggagggcagc
accggcagtaagcgtcgggtgatggaggaagacctgggagtagaggaccacaagaagagt
cgggtagaggaaggagaggaggaggagagggagggggagaggaaggaggaggaagaagca
gagagaccagaggatgagggatggggcgtcttcaaggcagacggggtggatatccgtgtg
gaggggaagaagaggctggggaaagatcaggccacagaagtcaagcagtctactggggaa
acgttcttcattgacaaaagtcctcctccaccagctccattcaaccatcggatagtgtcg
gccaaacccaaccagatcagcaacttctacaccatcaacagagttgagattctaggaggg
ggtcgttttggccaggtgcacaaatgcatggaaaactcctcaggtctcacgctagcttcc
aaaatcatcaaagcccggagtcagaaagaaaaggaggtggtcaagaatgagatcatggtc
atgaaccagttggatcacgccaacctgatccagctctacgccgcctacgagtccaggaat
gatatcatcctggtgctggaatatgtggatggtggggagctctttgaccggatcatcgac
gagaactacactctgatggagctggacacggtcatgttcatcaggcagatctgtgagggc
cttcagcacatgcacaagatgtacatcctccatctggacctcaagccggagaatattcta
tgtgtgagcagagtcacaaataaaatcaagatcattgactttggacttgccagaaaatac
atgcccagagagaagttgcgagtgaatttcggcaccccagagttcctggccccagaagtt
gtcaactacgactttgtgtcattcaacaccgatatgtggagtctgggagtcattacatat
atgcttctcagcggtctgtgtcctttcctgggcgacaataaccctgagactctgaacaac
atccttgcctgccagtggaactttgacgaggaagaatttacagacatatcagaggaagcc
aaagacttcatctctaaactactcatcgtcaataaaagttggaggataggtgcctctgaa
gcattgaggcatccttggctctctgacccagtcctccatcaccgacttcatgaaaagaag
aacatgtgtcactgttcccggcgatcttcatgcgtacccattacagagagttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234141
Entry
112234141         CDS       T05605                                 

Definition
(RefSeq) myosin light chain kinase, smooth muscle-like isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112234141
   04020 Calcium signaling pathway
    112234141
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112234141
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112234141
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112234141
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112234141
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     112234141
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   112234141
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig Pkinase PK_Tyr_Ser-Thr V-set C2-set_2 fn3 Kinase-like Kdo
Other DBs
NCBI-GeneID: 112234141
NCBI-ProteinID: XP_024257910
LinkDB
Position
Unknown
AA seq 1860 aa
MGDVQLVTTTRISKTSLTQGRGSPSQDPPAFTLPPRNARVSLGGTARLDGKVRGNPEPQV
TWSRNGKAVTAGERFVMEQSSRGTFSLVVHGVQEEDAGRYTCEAVNDAGSRQVTVEITIE
GNTGKKSRLPSSRTGGRFGVSTMESMPSIWGESPPKFVTRPSRIFVRLGQSGKFSAKITG
RPQPLVTWLKGDEELHTSSHFNMFEKSGIHFLEIRDVCVDDAGMYTCSVANSAGKATATA
ELNVQGSGSEAGILGPSAPVAPVPKTTDSPEVKHTSNGLLADRRSPTKTGDRTETRERLA
TLTRETKDHTELTKATWKDTMVSPKTTILASPKPPADLPDEAPRKPGVATPKAASSTSLQ
HHLRGQGAAKTSPDPHRAPERDTRDRVKTPPVGVQSLPQPSPEPTRETRRQARESRSART
AVTAGAPPKFDSVPQSQDTKEGTKVAFKCQVSGSPVAGLSWVKDGFPLRPRAGLSFQQDG
NTHILTVDNVQKRDSGTYGCTLTTSTGKVSSTWNLTVKNPRLEGKPPAFSTVLKGCSVSE
GQDFLLQCSVEGEPLPNISWLLNDKPVPHAHSAFENGLTQLTVQGALPEDEGQYACVAEN
SHGRAVCTSRVIVKGGLGSLYIGPKNIFKRTDPPNAVDTKKPSKPSAPVFLRGLKDLKVM
DGSKVIMTVEVTGNPHPEIVWLHNGKEIHKSEDFHFERKGSQCSLFIQEVFPEDTGKYTC
EVWNEVGEVRTEASLTVQEPQDGVQPWFITKPKSTTASLGQNVLLSCAIAGDPFPQWSWM
KQGQVVTTGLDYEILQKEDVVSLLIRRVRSHHAGDYEISLRNKVGDCSCVATLLVSEGAV
VSSGEHQTLEPCQRVGGVDGTVRGRGAPSSSTSASSSSIQQQQESEEPSAARGLLKRRVE
TKEHPEDQIRLQEAEQRDFRTVLGRKVTTKSVSEEDLKEITAEQMDFRSQLQPRGVKPKT
LSEDERKVNAPAQVDFRAVLGKKGGAPKQGAAPAEKGEPADFRSVLANKKKQTSLENNGE
SPAPAAALAPAAATPKAPASSPDKKEKEKNTVNCVGGGIIDKKNNNIGKEPVFSQKLSDV
SVVDGARLRLQCQVTCDPPATTTWTLDGKVIKPSKFIKLSNEGGQCSLTIDKALPEDEGQ
YKCRAENSAGKAECSCMVLVDDPTDTNSTAADKKIKKPSTPTSESEARIKKPNTKMPPKQ
AMPPQIVQFPDDMKILAGEKVEILCKFGGAPPVNCTWLKFRKPIQEVKGDLTIETTEVTS
KLTIADSQQDHCGCYTLELRNSYGLRQAALNLTIVDKPDPPARVPAASDIRRSTLTLSWY
GPTYDGGSAVQSYNLEIWNSVDKEWKNLVSCNSTSYNVQNLLGQRQYKFRVRAVNIYGIG
EPSAESEAVTMLEEDVEEKEEVEDDEEKEPDYRDVIVRTDVKVKDLYDVEERLGTGKFGQ
VFKLLEKGTKKHWAGKFIKAYSAKEKDNVRQEIAIMNSLHHPKLVQCIDAFEGKSDIVMV
LEMISGGELFERIIDEDFELTEREVIKYMLQIVDGVHYIHKQGIVHLDLKPENIMCVNKT
GNTIKLIDFGLARRLESSGTLKVLFGTPEFVAPEVINYEAISYPTDMWSIGVICYILVSG
LSPFMGDNDNETLSNVTSATWDFEDDAFDEISDHAKDFITNLLKKDMKARLTCDQCYEHP
WLKQDTGKMEAKKLSKERMKKYILRRKWQKTGHAVRAIGRLSSMAMLAGVSAKKGSPTEE
DNQFLECLEYEEKTQVKPTFSSVIKDVEVVEGSAARFDCKIEGYPDPEVVWYKDEQPIKE
TRHFQIDYDEEGNCSLVISEVNGDDDAKYTVKAVNSLGEATCTAELLVEVMEEEEEEEEE
NT seq 5583 nt   +upstreamnt  +downstreamnt
atgggggatgtgcagcttgtgacaacaacgcggatctccaagaccagcctgacacaaggc
cgaggttccccaagtcaggatcctccagccttcactctcccaccccgcaatgcccgggtc
agtctgggagggacagcgcggctggatgggaaggtgagaggaaaccctgagccccaggtc
acgtggtccaggaatgggaaagcagtgacggctggagagcggttcgtcatggaacagagt
agccgcggaaccttcagcctggtggtacacggtgtccaggaggaggatgcagggcgttac
acgtgtgaggctgtcaacgatgctgggagccgccaggtcacagtggagatcactatagaa
gggaacacagggaagaaatccagactcccctccagtagaacaggtgggcggtttggagtg
tcaaccatggagagtatgcccagtatctggggggagagcccccctaagtttgtgacaagg
ccctcgcgcatctttgtccgattgggacagagtggcaagttctctgccaaaatcacagga
cgcccacagcccctggttacctggcttaagggagatgaagagcttcatacttcttcccac
ttcaacatgtttgagaagtcgggaatccacttcctggagatccgagacgtgtgtgtggac
gatgcaggaatgtacacctgctctgtggccaacagtgctgggaaggccacagctacagca
gagctgaatgttcagggttcaggcagtgaggctggcatccttggtccctctgctccggtg
gcccctgtcccaaagacaactgactcacccgaagtcaagcacacaagtaacggcctgctc
gctgaccggcgttcacctaccaagacaggagacaggactgagaccagagagagactcgcc
acactcaccagggagaccaaagaccacacagagctgaccaaagcaacatggaaggacacc
atggtgtctcccaagaccaccatcctggcgtctcccaagccccctgcagacctgcctgat
gaggcccctagaaagcctggagtggcaaccccaaaggctgccagctctaccagtctgcaa
caccatctaagaggccagggagctgctaagaccagcccagacccacacagagcccctgag
agggatacaagggatagggtgaagactcccccagtgggagtccagagcctcccacagcca
tctccagagcccactagagagactagaaggcaggccagagagagcaggtcagcgaggaca
gcagtgactgctggagctccaccaaaatttgactctgtacctcagagccaggacactaaa
gaggggaccaaagtcgcattcaaatgccaagtctcaggctctcccgtggctggcctgagc
tgggttaaagatggcttccctttgagacccagagcagggctgagcttccagcaggacggc
aacactcacatcctcactgtggacaacgtccagaaaagggacagtgggacgtacggatgc
accctgactactagcactgggaaggtgtcctcgacttggaatctcacggtcaagaaccca
cggctggagggcaagccccctgcgttcagcactgtcctgaagggatgttcagtgagtgag
ggccaggacttccttctgcagtgttcagtggagggggagcctctaccgaacatctcctgg
ctcctaaacgacaagccagtgccgcatgcccactctgcctttgagaatggcctgacccaa
ctcactgtccagggtgcactgccagaggacgaaggccagtacgcgtgtgttgctgagaac
agccatgggagagcagtgtgcacttccagagtcatcgtcaaaggtgggcttgggagcctc
tacattggcccgaagaacattttcaagaggacggaccctccaaatgcagttgacaccaag
aagccgtcgaagccgtctgcccctgtattcctacgtggtctgaaggatctgaaagtcatg
gacggtagcaaagtcatcatgaccgtagaggtgacggggaatcctcatccagagattgtg
tggctccacaatgggaaggagatccacaagtcagaggacttccactttgagcgaaagggg
agccaatgcagtctgttcatccaggaagtcttccctgaggacactgggaagtacacctgt
gaggtgtggaacgaagtgggagaggttcgcaccgaggcctcgctcactgtgcaagagccc
caggacggggtgcagccctggttcatcactaagcccaagtccaccactgcctccttgggc
cagaatgtcctgctgtcctgtgccattgctggggaccccttcccccagtggagctggatg
aagcagggccaggtggtgaccactgggctggactatgagattctgcagaaagaggatgtg
gtgtccctgctcatcaggcgagtccggtcccaccacgccggggactacgagatcagcctg
aggaacaaagtgggtgactgcagttgtgttgccactctgttggtcagtgagggtgctgtg
gtgtccagtggagagcaccaaacgcttgagccttgtcagcgtgtgggaggagtggacggg
acagtgcgaggcagaggagcaccgagcagcagcactagcgctagcagcagctccattcag
cagcagcaggagtcggaggagcccagcgcagcccgaggactcctgaagaggcgcgtggag
accaaggagcacccagaggaccagatccgcctgcaggaggctgagcagcgcgacttccgc
acggtgctgggcaggaaagtcaccaccaagagcgtctccgaggaggacctgaaggagatc
acggcggaacagatggacttcaggagccagctccagcccagaggggtcaagccgaagacc
ctgtctgaagatgagaggaaggtcaacgctcccgcacaggtggacttcagagccgtcctg
gggaagaaggggggagcccctaaacaaggcgccgctcctgccgaaaaaggagagcctgca
gattttagatcggttctggccaacaagaagaagcagacgagcttggagaacaacggggag
agccctgctccagcagcagctctggcaccagcagcagcaacacccaaagctcctgcttct
tcccctgacaagaaagagaaggagaagaacactgtcaactgtgtgggtggtgggattatt
gataagaagaataacaacattggaaaggagccagtgttcagtcagaagctgagtgatgtg
agcgtggtggacggggctcgactgcgactacagtgccaggtgacctgtgacccccctgct
accactacctggacactagacgggaaggtcatcaagccgtccaagtttatcaagctgtcc
aacgaaggaggccagtgctccctgaccatcgacaaggccctgcccgaggatgagggccag
tacaagtgtcgggcagagaattctgccggtaaagctgagtgttcctgcatggtgctggtg
gatgatcctacagacacaaactcgactgcagcagacaagaagatcaagaagccatccacc
cctacctcagagagtgaggcgaggataaagaaaccgaatacaaagatgcctcccaaacag
gctatgccccctcagattgtccagttcccagacgacatgaagattctggcaggggagaag
gtggaaattctctgtaagtttggaggagctccaccagtcaactgcacctggctcaagttc
cgcaaaccaattcaagaggtcaaaggtgatttaaccattgaaaccactgaggtcaccagt
aaactgaccatcgcagacagccagcaggaccactgtggctgctacaccctcgaactgcga
aacagctacggcttgagacaggcagctctcaacctcaccattgtggacaaacctgatccc
cctgcacgagttccagccgcctcagacatccgccgctccacactcacactgtcatggtac
ggccccacctacgacgggggcagtgccgtccagtcctacaacctagagatatggaactca
gtggacaaggagtggaagaacctcgtctcctgcaacagcacctcctataatgtccagaac
ctgctgggtcagcgccagtacaagttcagggtgcgggcggtcaatatctacggcatcggg
gagcccagtgccgagtctgaggctgtcacaatgttagaggaggatgttgaggaaaaggag
gaagttgaggatgatgaagagaaagagccagactacagagatgtgatcgttagaacagat
gtgaaagtaaaggatctgtatgatgtggaagagaggctcggaacggggaaattcggacag
gtattcaaacttttggagaagggaacgaaaaagcactgggctggaaagttcatcaaggcc
tactctgcaaaagagaaagataatgtgagacaagagattgcaataatgaactccctccat
cacccaaaacttgtccagtgcattgatgccttcgaaggcaagtcagacatcgtcatggtt
ttggaaatgatctctggtggggagctgtttgagcgtatcatcgatgaagactttgagctg
acagaaagggaggtcattaagtacatgctgcagattgtggacggggttcactacatccac
aagcagggcatcgtccatctggacctgaagcctgagaatatcatgtgtgtcaacaagacc
gggaacaccatcaaactcattgacttcggcctcgctcgcagactagaaagctctggaaca
ttgaaagttctgtttggaacccctgagtttgtggcccctgaagtgatcaactatgaagca
atcagttatccaacagacatgtggagtataggggtcatctgctacatcctggtgagtggc
ctgtccccattcatgggggataacgacaacgagaccctttccaatgtgacctcggccact
tgggactttgaagacgacgccttcgatgagatctcagaccacgccaaggacttcattacc
aacttgctgaagaaagatatgaaggctaggctgacatgcgatcagtgctatgagcacccg
tggctaaaacaagacactggcaaaatggaggccaagaaactgtccaaggagaggatgaag
aagtacatcttgagaaggaaatggcagaaaaccggacatgcagtgcgggccatcggaagg
ctgtcatcaatggcgatgttggcgggcgtcagtgccaagaaaggctcccctactgaagag
gacaaccagttccttgaatgcctagagtatgaggagaaaacccaggtcaagcccaccttc
agctcagtcatcaaggatgtggaggtggtggaggggagcgcagccagatttgactgcaag
atcgagggctaccctgatccagaggtggtgtggtacaaagacgaacagccaatcaaggag
acccgccacttccagattgattacgacgaggagggcaactgcagcctggtgatctcggaa
gtgaacggcgacgacgatgccaaatacaccgtcaaggctgtcaacagcctgggcgaggcc
acgtgcacagccgaactcctggtggaggtgatggaggaagaggaggaggaggaggaggaa
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112235615
Entry
112235615         CDS       T05605                                 

Definition
(RefSeq) myosin light chain kinase, smooth muscle-like isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112235615
   04020 Calcium signaling pathway
    112235615
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112235615
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112235615
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112235615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112235615
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     112235615
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   112235615
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig Pkinase PK_Tyr_Ser-Thr V-set C2-set_2 fn3 Kinase-like Kdo
Other DBs
NCBI-GeneID: 112235615
NCBI-ProteinID: XP_024259856
LinkDB
Position
3
AA seq 1860 aa
MGDVQLVTTTRISKTSLTQGRGSPSQDPPAFTLPPRNARVSLGGTARLDGKVRGNPEPQV
TWSRNGKAVTAGERFVMEQSSRGTFSLVVHGVQEEDAGRYTCEAVNDAGSRQVTVEITIE
GNTGKKSRLPSSRTGGRFGVSTMESMPSIWGESPPKFVTRPSRIFVRLGQSGKFSAKITG
RPQPLVTWLKGDEELHTSSHFNMFEKSGIHFLEIRDVCVDDAGMYTCSVANSAGKATATA
ELNVQGSGSEAGILGPSAPVAPVPKTTDSPEVKHTSNGLLADRRSPTKTGDRTETRERLA
TLTRETKDHTELTKATWKDTMVSPKTTILASPKPPADLPDEAPRKPGVATPKAASSTSLQ
HHLRGQGAAKTSPDPHRAPERDTRDRVKTPPVGVQSLPQPSPEPTRETRRQARESRSART
AVTAGAPPKFDSVPQSQDTKEGTKVAFKCQVSGSPVAGLSWVKDGFPLRPRAGLSFQQDG
NTHILTVDNVQKRDSGTYGCTLTTSTGKVSSTWNLTVKNPRLEGKPPAFSTVLKGCSVSE
GQDFLLQCSVEGEPLPNISWLLNDKPVPHAHSAFENGLTQLTVQGALPEDEGQYACVAEN
SHGRAVCTSRVIVKGGLGSLYIGPKNIFKRTDPPNAVDTKKPSKPSAPVFLRGLKDLKVM
DGSKVIMTVEVTGNPHPEIVWLHNGKEIHKSEDFHFERKGSQCSLFIQEVFPEDTGKYTC
EVWNEVGEVRTEASLTVQEPQDGVQPWFITKPKSTTASLGQNVLLSCAIAGDPFPQWSWM
KQGQVVTTGLDYEILQKEDVVSLLIRRVRSHHAGDYEISLRNKVGDCSCVATLLVSEGAV
VSSGEHQTLEPCQRVGGVDGTVRGRGAPSSSTSASSSSIQQQQESEEPSAARGLLKRRVE
TKEHPEDQIRLQEAEQRDFRTVLGRKVTTKSVSEEDLKEITAEQMDFRSQLQPRGVKPKT
LSEDERKVNAPAQVDFRAVLGKKGGAPKQGAAPAEKGEPADFRSVLANKKKQTSLENNGE
SPAPAAALAPAAATPKAPASSPDKKEKEKNTVNCVGGGIIDKKNNNIGKEPVFSQKLSDV
SVVDGARLRLQCQVTCDPPATTTWTLDGKVIKPSKFIKLSNEGGQCSLTIDKALPEDEGQ
YKCRAENSAGKAECSCMVLVDDPTDTNSTAADKKIKKPSTPTSESEARIKKPNTKMPPKQ
AMPPQIVQFPDDMKILAGEKVEILCKFGGAPPVNCTWLKFRKPIQEVKGDLTIETTEVTS
KLTIADSQQDHCGCYTLELRNSYGLRQAALNLTIVDKPDPPARVPAASDIRRSTLTLSWY
GPTYDGGSAVQSYNLEIWNSVDKEWKNLVSCNSTSYNVQNLLGQRQYKFRVRAVNIYGIG
EPSAESEAVTMLEEDVEEKEEVEDDEEKEPDYRDVIVRTDVKVKDLYDVEERLGTGKFGQ
VFKLLEKGTKKHWAGKFIKAYSAKEKDNVRQEIAIMNSLHHPKLVQCIDAFEGKSDIVMV
LEMISGGELFERIIDEDFELTEREVIKYMLQIVDGVHYIHKQGIVHLDLKPENIMCVNKT
GNTIKLIDFGLARRLESSGTLKVLFGTPEFVAPEVINYEAISYPTDMWSIGVICYILVSG
LSPFMGDNDNETLSNVTSATWDFEDDAFDEISDHAKDFITNLLKKDMKARLTCDQCYEHP
WLKQDTGKMEAKKLSKERMKKYILRRKWQKTGHAVRAIGRLSSMAMLAGVSAKKGSPTEE
DNQFLECLEYEEKTQVKPTFSSVIKDVEVVEGSAARFDCKIEGYPDPEVVWYKDEQPIKE
TRHFQIDYDEEGNCSLVISEVNGDDDAKYTVKAVNSLGEATCTAELLVEVMEEEEEEEEE
NT seq 5583 nt   +upstreamnt  +downstreamnt
atgggggatgtgcagcttgtgacaacaacgcggatctccaagaccagcctgacacaaggc
cgaggttccccaagtcaggatcctccagccttcactctcccaccccgcaatgcccgggtc
agtctgggagggacagcgcggctggatgggaaggtgagaggaaaccctgagccccaggtc
acgtggtccaggaatgggaaagcagtgacggctggagagcggttcgtcatggaacagagt
agccgcggaaccttcagcctggtggtacacggtgtccaggaggaggatgcagggcgttac
acgtgtgaggctgtcaacgatgctgggagccgccaggtcacagtggagatcactatagaa
gggaacacagggaagaaatccagactcccctccagtagaacaggtgggcggtttggagtg
tcaaccatggagagtatgcccagtatctggggggagagcccccctaagtttgtgacaagg
ccctcgcgcatctttgtccgattgggacagagtggcaagttctctgccaaaatcacagga
cgcccacagcccctggttacctggcttaagggagatgaagagcttcatacttcttcccac
ttcaacatgtttgagaagtcgggaatccacttcctggagatccgagacgtgtgtgtggac
gatgcaggaatgtacacctgctctgtggccaacagtgctgggaaggccacagctacagca
gagctgaatgttcagggttcaggcagtgaggctggcatccttggtccctctgctccggtg
gcccctgtcccaaagacaactgactcacccgaagtcaagcacacaagtaacggcctgctc
gctgaccggcgttcacctaccaagacaggagacaggactgagaccagagagagactcgcc
acactcaccagggagaccaaagaccacacagagctgaccaaagcaacatggaaggacacc
atggtgtctcccaagaccaccatcctggcgtctcccaagccccctgcagacctgcctgat
gaggcccctagaaagcctggagtggcaaccccaaaggctgccagctctaccagtctgcaa
caccatctaagaggccagggagctgctaagaccagcccagacccacacagagcccctgag
agggatacaagggatagggtgaagactcccccagtgggagtccagagcctcccacagcca
tctccagagcccactagagagactagaaggcaggccagagagagcaggtcagcgaggaca
gcagtgactgctggagctccaccaaaatttgactctgtacctcagagccaggacactaaa
gaggggaccaaagtcgcattcaaatgccaagtctcaggctctcccgtggctggcctgagc
tgggttaaagatggcttccctttgagacccagagcagggctgagcttccagcaggacggc
aacactcacatcctcactgtggacaacgtccagaaaagggacagtgggacgtacggatgc
accctgactactagcactgggaaggtgtcctcgacttggaatctcacggtcaagaaccca
cggctggagggcaagccccctgcgttcagcactgtcctgaagggatgttcagtgagtgag
ggccaggacttccttctgcagtgttcagtggagggggagcctctaccgaacatctcctgg
ctcctaaacgacaagccagtgccgcatgcccactctgcctttgagaatggcctgacccaa
ctcactgtccagggtgcactgccagaggacgaaggccagtacgcgtgtgttgctgagaac
agccatgggagagcagtgtgcacttccagagtcatcgtcaaaggtgggcttgggagcctc
tacattggcccgaagaacattttcaagaggacggaccctccaaatgcagttgacaccaag
aagccgtcgaagccgtctgcccctgtattcctacgtggtctgaaggatctgaaagtcatg
gacggtagcaaagtcatcatgaccgtagaggtgacggggaatcctcatccagagattgtg
tggctccacaatgggaaggagatccacaagtcagaggacttccactttgagcgaaagggg
agccaatgcagtctgttcatccaggaagtcttccctgaggacactgggaagtacacctgt
gaggtgtggaacgaagtgggagaggttcgcaccgaggcctcgctcactgtgcaagagccc
caggacggggtgcagccctggttcatcactaagcccaagtccaccactgcctccttgggc
cagaatgtcctgctgtcctgtgccattgctggggaccccttcccccagtggagctggatg
aagcagggccaggtggtgaccactgggctggactatgagattctgcagaaagaggatgtg
gtgtccctgctcatcaggcgagtccggtcccaccacgccggggactacgagatcagcctg
aggaacaaagtgggtgactgcagttgtgttgccactctgttggtcagtgagggtgctgtg
gtgtccagtggagagcaccaaacgcttgagccttgtcagcgtgtgggaggagtggacggg
acagtgcgaggcagaggagcaccgagcagcagcactagcgctagcagcagctccattcag
cagcagcaggagtcggaggagcccagcgcagcccgaggactcctgaagaggcgcgtggag
accaaggagcacccagaggaccagatccgcctgcaggaggctgagcagcgcgacttccgc
acggtgctgggcaggaaagtcaccaccaagagcgtctccgaggaggacctgaaggagatc
acggcggaacagatggacttcaggagccagctccagcccagaggggtcaagccgaagacc
ctgtctgaagatgagaggaaggtcaacgctcccgcacaggtggacttcagagccgtcctg
gggaagaaggggggagcccctaaacaaggcgccgctcctgccgaaaaaggagagcctgca
gattttagatcggttctggccaacaagaagaagcagacgagcttggagaacaacggggag
agccctgctccagcagcagctctggcaccagcagcagcaacacccaaagctcctgcttct
tcccctgacaagaaagagaaggagaagaacactgtcaactgtgtgggtggtgggattatt
gataagaagaataacaacattggaaaggagccagtgttcagtcagaagctgagtgatgtg
agcgtggtggacggggctcgactgcgactacagtgccaggtgacctgtgacccccctgct
accactacctggacactagacgggaaggtcatcaagccgtccaagtttatcaagctgtcc
aacgaaggaggccagtgctccctgaccatcgacaaggccctgcccgaggatgagggccag
tacaagtgtcgggcagagaattctgccggtaaagctgagtgttcctgcatggtgctggtg
gatgatcctacagacacaaactcgactgcagcagacaagaagatcaagaagccatccacc
cctacctcagagagtgaggcgaggataaagaaaccgaatacaaagatgcctcccaaacag
gctatgccccctcagattgtccagttcccagacgacatgaagattctggcaggggagaag
gtggaaattctctgtaagtttggaggagctccaccagtcaactgcacctggctcaagttc
cgcaaaccaattcaagaggtcaaaggtgatttaaccattgaaaccactgaggtcaccagt
aaactgaccatcgcagacagccagcaggaccactgtggctgctacaccctcgaactgcga
aacagctacggcttgagacaggcagctctcaacctcaccattgtggacaaacctgatccc
cctgcacgagttccagccgcctcagacatccgccgctccacactcacactgtcatggtac
ggccccacctacgacgggggcagtgccgtccagtcctacaacctagagatatggaactca
gtggacaaggagtggaagaacctcgtctcctgcaacagcacctcctataatgtccagaac
ctgctgggtcagcgccagtacaagttcagggtgcgggcggtcaatatctacggcatcggg
gagcccagtgccgagtctgaggctgtcacaatgttagaggaggatgttgaggaaaaggag
gaagttgaggatgatgaagagaaagagccagactacagagatgtgatcgttagaacagat
gtgaaagtaaaggatctgtatgatgtggaagagaggctcggaacggggaaattcggacag
gtattcaaacttttggagaagggaacgaaaaagcactgggctggaaagttcatcaaggcc
tactctgcaaaagagaaagataatgtgagacaagagattgcaataatgaactccctccat
cacccaaaacttgtccagtgcattgatgccttcgaaggcaagtcagacatcgtcatggtt
ttggaaatgatctctggtggggagctgtttgagcgtatcatcgatgaagactttgagctg
acagaaagggaggtcattaagtacatgctgcagattgtggacggggttcactacatccac
aagcagggcatcgtccatctggacctgaagcctgagaatatcatgtgtgtcaacaagacc
gggaacaccatcaaactcattgacttcggcctcgctcgcagactagaaagctctggaaca
ttgaaagttctgtttggaacccctgagtttgtggcccctgaagtgatcaactatgaagca
atcagttatccaacagacatgtggagtataggggtcatctgctacatcctggtgagtggc
ctgtccccattcatgggggataacgacaacgagaccctttccaatgtgacctcggccact
tgggactttgaagacgacgccttcgatgagatctcagaccacgccaaggacttcattacc
aacttgctgaagaaagatatgaaggctaggctgacatgcgatcagtgctatgagcacccg
tggctaaaacaagacactggcaaaatggaggccaagaaactgtccaaggagaggatgaag
aagtacatcttgagaaggaaatggcagaaaaccggacatgcagtgcgggccatcggaagg
ctgtcatcaatggcgatgttggcgggcgtcagtgccaagaaaggctcccctactgaagag
gacaaccagttccttgaatgcctagagtatgaggagaaaacccaggtcaagcccaccttc
agctcagtcatcaaggatgtggaggtggtggaggggagcgcagccagatttgactgcaag
atcgagggctaccctgatccagaggtggtgtggtacaaagacgaacagccaatcaaggag
acccgccacttccagattgattacgacgaggagggcaactgcagcctggtgatctcggaa
gtgaacggcgacgacgatgccaaatacaccgtcaaggctgtcaacagcctgggcgaggcc
acgtgcacagccgaactcctggtggaggtgatggaggaagaggaggaggaggaggaggaa
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112246651
Entry
112246651         CDS       T05605                                 

Definition
(RefSeq) myosin light chain kinase 2, skeletal/cardiac muscle-like isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112246651
   04020 Calcium signaling pathway
    112246651
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112246651
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112246651
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112246651
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112246651
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     112246651
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   112246651
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like NACHT_N
Other DBs
NCBI-GeneID: 112246651
NCBI-ProteinID: XP_024270892
LinkDB
Position
Unknown
AA seq 775 aa
MVDRSAAEPTMSSSLVNSLAKVYDPNPLHGQKLAGTKLIRSPTGPDKQPQTQSSPSSSSS
SSSSPVIVTWCVETESRMDSLSSQMERLLNLQETVITRLDGLSRDLGGVGREVASLRSGA
WGSAGSLGQTQGKTQTQGVEVEGQTQEVAAACRVLQGVVQEASQRVEQQGKRLEGVERLV
EGMHQVIGFIGEVVKSSLLAELLFNKPGGCKGAKAKQARKLKGNGMRDGKDKAKLSLKCL
KAQKKKPPDASDSVEALLLDQVEKLNRHNAERSHGNGVVLDMPHIPVVQYMEELEGKEEE
KRKTPEQEEEQRAREEEGEGDLFGESDPEEEEGREGEALKIKVEHVQEEDGEKRGEGGEK
ESSEPLESSAELGEVAASSKRGIKEEYWVKENLKKSRVEERKEGEEEEEGVPEGSELQAA
QSEAEKTEKEEEVDDGQPKEYIIDSSPPPAAPFDHRIVTPKPHQVTTFYTINREEVLGGG
RFGQVHKCVENSSGLKLAAKIIKARSQKEKDVVKNEIQVMNQLNHANLIQLYAAFESHHD
IILVMEYVDGGELFDRIIDENYNLTELDTVLFIRQICEGLQYMHKMYILHLDLKPENILC
VSRATNKIKIIDFGLARRYKPREKLRVNFGTPEFLAPEVINYEFVSFPTDMWSLGVITYM
LLTGLSPFLGDDDNETLNNILACQWNFEEEEFTDISEEAKDFIARLLIKSNSWRMSASQS
LKHSWLSDRNLHYRLHQKKNKCHSTHPHPPRKSRPSPIQNESPLQKDSQDPVGTL
NT seq 2328 nt   +upstreamnt  +downstreamnt
atggttgaccgctctgctgcggaacccaccatgagctccagtctggtcaactctcttgcc
aaggtgtacgaccccaaccctcttcatggtcagaaactggccgggacaaagctgatacgt
tcacccactggacctgacaaacaaccccagacacagtcctcaccctcttcctcctcctcc
tcctcctcttctccggtcattgttacatggtgcgttgagactgaaagccgcatggactct
ctaagcagccagatggagcgtctgcttaacctccaggagaccgtcatcacccggctggac
ggcctgtcccgggacctggggggcgtggggagggaggtggcctctctccggtccggggcc
tgggggtcggctggaagtctgggccagacccagggtaagacccagacccagggggtggag
gtggagggtcagacccaggaggtggctgcggcctgtagggtgctccagggggtggtgcag
gaggccagccagcgagtggagcagcaggggaagagactggagggagtggagaggctggtg
gagggaatgcatcaggtcatcggtttcatcggagaggtggtgaagagctctctgctggct
gagctgctgtttaataagcctggaggctgtaagggggctaaggccaaacaagccaggaag
ctgaagggcaacgggatgagggatgggaaggacaaggccaagctcagcctgaagtgcctg
aaagcccagaagaagaagcctccagatgcatcagactctgtagaggccctccttctagac
caggtagagaagctcaacaggcataatgccgagcgttcccatggtaatggggtggttctg
gacatgccccacatccctgttgtccaatacatggaagagctagaggggaaggaggaggag
aagaggaaaacccctgagcaggaggaagagcagagggccagagaagaggaaggggagggg
gatttatttggtgaatctgaccccgaggaagaggagggaagagagggagaggcactgaag
attaaggtggagcacgttcaagaggaagacggggagaagagaggggaaggaggggagaaa
gagtcatcagaacctctagaaagttctgcggagttaggtgaggtggctgccagcagtaaa
cgtggaatcaaagaggagtattgggtgaaagaaaacttgaagaagagtcgagtggaggaa
aggaaagagggggaagaggaggaagaaggagttcctgagggttcagagcttcaggctgcc
caatcagaggcagagaagacagagaaggaagaggaggtggatgatggacagccaaaagag
tacatcattgactctagccctcctccagcagccccctttgaccaccgcatcgtgactccg
aaacctcaccaggttactaccttctacaccattaacagagaggaggtcctaggaggggga
cgttttggacaagtccataaatgcgtagagaactcttctggactgaagctggctgccaag
attatcaaagccaggagccagaaagagaaggacgtggtgaagaatgagatccaggtgatg
aaccaactcaatcacgccaacctgatccagctctacgctgccttcgagtcacaccacgac
atcatcctcgtcatggaatatgtggatggaggggagctgtttgaccggatcatagacgag
aactacaacctgacagagctggacacggtgctgttcatcagacagatctgtgagggatta
cagtacatgcacaagatgtacatcttacatctcgacctcaagccggagaacattctgtgt
gtgagcagagctacaaacaagatcaaaataatagactttgggcttgcaagaaggtataag
cccagggaaaagttgagggttaattttggaacgccggaattcctagctccggaagtcatc
aactatgaatttgtctcattccccacagacatgtggagtctgggggtcatcacatacatg
ctgctgactggtctgtctccattccttggtgacgatgacaacgagacactgaacaacatc
cttgcctgtcagtggaactttgaggaggaggagttcaccgacatctctgaggaggccaaa
gacttcattgcgcgcctgctgatcaagagcaatagttggaggatgagtgcctcacagtca
ctgaaacattcctggctgtcggaccgtaatcttcactaccgcctgcatcagaagaaaaat
aagtgccactcaacgcaccctcaccctccccgaaaatctagaccgtcccccatccagaat
gagtctcccctccaaaaggactcccaagaccctgtgggcaccttatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112249079
Entry
112249079         CDS       T05605                                 

Definition
(RefSeq) myosin light chain kinase 3-like isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112249079
   04020 Calcium signaling pathway
    112249079
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112249079
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112249079
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112249079
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112249079
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     112249079
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   112249079
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo APH
Other DBs
NCBI-GeneID: 112249079
NCBI-ProteinID: XP_024274487
LinkDB
Position
4
AA seq 825 aa
MSKPETLASCIAKMYEGGKLDNAGAPSGAMKKPTNSLLNSLGGMEVKLNQLEVKVEQIAC
SQTEVLRRLDMVCQGMGKLEKDLDQLRKDRDPQAGDRGSRGGGGDPALFSEVRVMCGETV
ALLKNLQQEGKWQREKIEGIESSVSAVDKLWGYVGEVFRSSKIVEFILKGIVPWRKQGLL
YIQEEEEKTKSEDSRVKPKVTLCDQGTQVQEEGLQITTGDKKAVELPVKEAKAADHGVEV
PTPPEPDPCRLSESLTEGPAVEEAIFPSTNSDRGSKGSRKPKEVTLKSREPTRVQTFAPD
VVVAQVEVTIEVLSELRRTPDVTMISVSSELDSQYIKVKETEVPKGPGPTVSQPPISTTE
EQPLEQAPESVSLPSKDDPLPEEDFTKAAVSPQEPVIIVTPPTPCSSALTSPLDVVTKPE
SATIVPQVQPEPVATTEQHKPVPPQPESETVKYSAKPVIPQPTPSLVVKNPTAAAQVAGL
DAQLLVIDDCPPLPAPFEHRIVSAKQVPMGSYYAVKPNAVLGGGRFGQVHKCAELSSGLI
LAAKLIKVKGMRERDEVKNEIGVMNQLNHVNLIQLYDAFESRTNLTLIMEYVDGGELFDR
IVDENYQLTELDAIVFMRQICEGVQYLHQQYILHLDLKPENILCVNSTGNQIKIIDFGLA
RKYRPREKLKVNFGTPEFLAPEVVNYDFVSFPTDMWSVGVITYMLLSGLSPFLGDNDAET
MNNILHANWDFDSEAFENVTEEAKDFVTRLLIPTKCSRLSATGCMKHAWLNNLEDKAKLH
QVRLKSQVKLQRYLAAHKQWKKHFYVVAAANRLKRFRQNHPINTV
NT seq 2478 nt   +upstreamnt  +downstreamnt
atgagtaaaccagagacattggcctcctgcattgccaagatgtacgaggggggtaaattg
gacaatgctggggccccttctggagcaatgaaaaagccaactaacagcctgctgaacagc
ctgggaggcatggaggtcaagctgaatcagcttgaggtgaaggtggagcagatagcttgt
agccagacagaggtcctcaggaggctggatatggtgtgtcagggcatggggaagctggag
aaggacctggaccagctcagaaaagacagggacccccaggcaggggacaggggctctcgt
ggaggtggaggggacccagccttgttctcggaggtcagggtaatgtgtggggagactgtg
gcactgctgaagaacctgcagcaggaggggaaatggcaacgggagaaaattgaaggaata
gagagctcggtttcggccgtggacaagctctggggatacgtgggggaagttttccgaagc
tctaagatagtggagttcatcttgaaaggcatcgtaccctggaggaaacagggcctgctg
tacatccaagaggaggaggagaaaacaaaatcagaagatagcagagtaaagcctaaagtc
actctttgcgaccaggggactcaggtccaggaagagggcttacaaatcaccacaggtgac
aagaaggcggtagagctccctgtaaaggaagcgaaggccgcagaccatggagtggaagtc
ccaactcctcctgagcctgatccctgcaggttatccgaatctctcacagagggccctgca
gtcgaggaggccatattcccatctaccaatagtgataggggaagtaaaggctctcgcaag
cccaaagaggtcaccttaaagagcagagagcccaccagagttcagacctttgcccctgat
gtggtcgtagctcaggtggaggtcaccatcgaagtgctctctgagctgaggaggactcct
gatgtgaccatgatttcggtgagcagtgagttagacagtcagtacatcaaagtcaaggag
accgaggttccaaaaggtccagggcccactgtatcacagccacctatctccaccactgag
gagcaaccgctggagcaagcccctgaaagtgtttctcttccttccaaggatgaccctctc
cctgaagaggactttacaaaggctgcagtcagtcctcaggaacctgttatcattgtaaca
ccaccaaccccatgcagcagtgcgctaacaagcccactggatgtggtcaccaaaccagag
tccgcaacgattgtccctcaggtccagcctgagccggtggcgaccacagagcagcacaaa
cctgttccacctcaaccagagtctgagacagtgaaatactctgcaaaaccagttatccct
cagccaactccctctttagttgttaaaaaccctacagcagctgcacaggtggcaggcctg
gatgcacaactattggtcatagatgactgcccacccttgcctgctccctttgagcaccgc
attgtgagtgccaagcaagtcccgatgggctcttattacgctgtaaagcctaacgcggtc
ctaggagggggacgttttgggcaggtccataagtgcgcagaactgtcgtcgggcctaatc
ctcgctgcgaagttgatcaaagtaaagggaatgagggagagagatgaagtgaagaatgaa
ataggggtgatgaaccaacttaaccatgtgaacctgattcagctttatgatgcctttgag
tcacggacaaaccttacgcttattatggagtatgtggacggtggtgagttgtttgaccgg
atcgttgacgagaactaccagctgacagagctggatgccatcgtgtttatgagacagatc
tgtgagggggtacagtacctccatcagcaatacattctccatttagacctcaagccagag
aacattctttgtgtcaactccacagggaaccagatcaagataatagactttggtctggcc
agaaagtatagacccagagagaaactaaaggtcaattttggcactccggaatttctggct
cctgaggtggtcaactacgactttgtctcattcccaacggacatgtggagtgtaggagtc
attacttatatgcttctgagtggactgtctccattcctgggggacaacgatgcagagact
atgaacaacatccttcacgccaactgggattttgattcagaggcatttgagaatgtcaca
gaggaagctaaggactttgttaccagactgcttattccaactaaatgcagtcgactcagt
gcaactggctgcatgaagcatgcctggctgaacaatctggaggataaagccaaattgcac
caggttcggctcaagtcccaagtcaagctccagcgctacctggccgctcacaaacagtgg
aagaaacacttctatgtggttgctgcagccaacaggctgaagaggtttcgccagaatcat
cccataaacactgtgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250079
Entry
112250079         CDS       T05605                                 

Definition
(RefSeq) myosin light chain kinase 2, skeletal/cardiac muscle-like isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112250079
   04020 Calcium signaling pathway
    112250079
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112250079
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112250079
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112250079
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112250079
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     112250079
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   112250079
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like NACHT_N
Other DBs
NCBI-GeneID: 112250079
NCBI-ProteinID: XP_024275705
LinkDB
Position
1
AA seq 775 aa
MVDRSAAEPTMSSSLVNSLAKVYDPNPLHGQKLAGTKLIRSPTGPDKQPQTQSSPSSSSS
SSSSPVIVTWCVETESRMDSLSSQMERLLNLQETVITRLDGLSRDLGGVGREVASLRSGA
WGSAGSLGQTQGKTQTQGVEVEGQTQEVAAACRVLQGVVQEASQRVEQQGKRLEGVERLV
EGMHQVIGFIGEVVKSSLLAELLFNKPGGCKGAKAKQARKLKGNGMRDGKDKAKLSLKCL
KAQKKKPPDASDSVEALLLDQVEKLNRHNAERSHGNGVVLDMPHIPVVQYMEELEGKEEE
KRKTPEQEEEQRAREEEGEGDLFGESDPEEEEGREGEALKIKVEHVQEEDGEKRGEGGEK
ESSEPLESSAELGEVAASSKRGIKEEYWVKENLKKSRVEERKEGEEEEEGVPEGSELQAA
QSEAEKTEKEEEVDDGQPKEYIIDSSPPPAAPFDHRIVTPKPHQVTTFYTINREEVLGGG
RFGQVHKCVENSSGLKLAAKIIKARSQKEKDVVKNEIQVMNQLNHANLIQLYAAFESHHD
IILVMEYVDGGELFDRIIDENYNLTELDTVLFIRQICEGLQYMHKMYILHLDLKPENILC
VSRATNKIKIIDFGLARRYKPREKLRVNFGTPEFLAPEVINYEFVSFPTDMWSLGVITYM
LLTGLSPFLGDDDNETLNNILACQWNFEEEEFTDISEEAKDFIARLLIKSNSWRMSASQS
LKHSWLSDRNLHYRLHQKKNKCHSTHPHPPRKSRPSPIQNESPLQKDSQDPVGTL
NT seq 2328 nt   +upstreamnt  +downstreamnt
atggttgaccgctctgctgcggaacccaccatgagctccagtctggtcaactctcttgcc
aaggtgtacgaccccaaccctcttcatggtcagaaactggccgggacaaagctgatacgt
tcacccactggacctgacaaacaaccccagacacagtcctcaccctcttcctcctcctcc
tcctcctcttctccggtcattgttacatggtgcgttgagactgaaagccgcatggactct
ctaagcagccagatggagcgtctgcttaacctccaggagaccgtcatcacccggctggac
ggcctgtcccgggacctggggggcgtggggagggaggtggcctctctccggtccggggcc
tgggggtcggctggaagtctgggccagacccagggtaagacccagacccagggggtggag
gtggagggtcagacccaggaggtggctgcggcctgtagggtgctccagggggtggtgcag
gaggccagccagcgagtggagcagcaggggaagagactggagggagtggagaggctggtg
gagggaatgcatcaggtcatcggtttcatcggagaggtggtgaagagctctctgctggct
gagctgctgtttaataagcctggaggctgtaagggggctaaggccaaacaagccaggaag
ctgaagggcaacgggatgagggatgggaaggacaaggccaagctcagcctgaagtgcctg
aaagcccagaagaagaagcctccagatgcatcagactctgtagaggccctccttctagac
caggtagagaagctcaacaggcataatgccgagcgttcccatggtaatggggtggttctg
gacatgccccacatccctgttgtccaatacatggaagagctagaggggaaggaggaggag
aagaggaaaacccctgagcaggaggaagagcagagggccagagaagaggaaggggagggg
gatttatttggtgaatctgaccccgaggaagaggagggaagagagggagaggcactgaag
attaaggtggagcacgttcaagaggaagacggggagaagagaggggaaggaggggagaaa
gagtcatcagaacctctagaaagttctgcggagttaggtgaggtggctgccagcagtaaa
cgtggaatcaaagaggagtattgggtgaaagaaaacttgaagaagagtcgagtggaggaa
aggaaagagggggaagaggaggaagaaggagttcctgagggttcagagcttcaggctgcc
caatcagaggcagagaagacagagaaggaagaggaggtggatgatggacagccaaaagag
tacatcattgactctagccctcctccagcagccccctttgaccaccgcatcgtgactccg
aaacctcaccaggttactaccttctacaccattaacagagaggaggtcctaggaggggga
cgttttggacaagtccataaatgcgtagagaactcttctggactgaagctggctgccaag
attatcaaagccaggagccagaaagagaaggacgtggtgaagaatgagatccaggtgatg
aaccaactcaatcacgccaacctgatccagctctacgctgccttcgagtcacaccacgac
atcatcctcgtcatggaatatgtggatggaggggagctgtttgaccggatcatagacgag
aactacaacctgacagagctggacacggtgctgttcatcagacagatctgtgagggatta
cagtacatgcacaagatgtacatcttacatctcgacctcaagccggagaacattctgtgt
gtgagcagagctacaaacaagatcaaaataatagactttgggcttgcaagaaggtataag
cccagggaaaagttgagggttaattttggaacgccggaattcctagctccggaagtcatc
aactatgaatttgtctcattccccacagacatgtggagtctgggggtcatcacatacatg
ctgctgactggtctgtctccattccttggtgacgatgacaacgagacactgaacaacatc
cttgcctgtcagtggaactttgaggaggaggagttcaccgacatctctgaggaggccaaa
gacttcattgcgcgcctgctgatcaagagcaatagttggaggatgagtgcctcacagtca
ctgaaacattcctggctgtcggaccgtaatcttcactaccgcctgcatcagaagaaaaat
aagtgccactcaacgcaccctcaccctccccgaaaatctagaccgtcccccatccagaat
gagtctcccctccaaaaggactcccaagaccctgtgggcaccttatga

DBGET integrated database retrieval system