KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222201Help
Entry
112222201         CDS       T05605                                 

Definition
(RefSeq) G/T mismatch-specific thymine DNA glycosylase-like isoform X1
  KO
K20813  thymine-DNA glycosylase [EC:3.2.2.29]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    112222201
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:otw03400]
    112222201
Enzymes [BR:otw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.29  thymine-DNA glycosylase
     112222201
DNA repair and recombination proteins [BR:otw03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     112222201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG Adaptin_binding
Motif
Other DBs
NCBI-GeneID: 112222201
NCBI-ProteinID: XP_024240654
LinkDB All DBs
Position
22
AA seq 454 aa AA seqDB search
MEEKLYGSVPVPSEYLQQWIQSAQQLQAQQGQYPGINHHHSPHPHYTEEPSEERVMAHAH
MAVNDELMAQQEPANLAKAPAKKRGRTAQPKEPKPPKMPKPPKAKPGPKPKKGKEGQEAD
GTQEKMDETVQKVRKKRDRFKGMTEDEVMSRTLTDILDYNLDYVIIGINPGLVAAYVGRW
FPGPGNHFWKCLFLSGFTDEQLNHMSDTSLPAKYKIGFTNMVARTTPGSKDLSTKELREG
ALILVEKLKKYKPLIAVFNGKCIYEMFCREMFGKKPKKLDFGLQPHKIPDCEVALYLMPS
SSARCAQFPRAQDKVHFYIKLRELRDQLRGVARTDDIQELEYTFDLGLAKEDAKRMAIKE
EAYDPGYEAAFGGAYGEGGPGPEEGQSNGNGHCNFSSAENTVSDAVEKADTSQLPAAAAT
EGQLPDGQWMMQSFADQIPDIGGSKEPQAWAGNV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaagctgtatggatcagtgcctgtcccctcggaatatcttcaacagtggatt
cagtcagctcaacagcttcaggctcagcagggccagtatccgggcatcaaccatcaccac
agtcctcaccctcactacacagaggaaccaagtgaagagagagtaatggcacatgcacat
atggctgtcaatgatgagctcatggctcagcaagaacctgccaacttagcgaaagctcca
gcgaaaaagcgagggagaacggcacaaccaaaggaacccaagccacccaaaatgcccaag
ccccctaaggccaaaccgggccccaagcccaagaaaggcaaggagggtcaagaggctgac
ggcacgcaggagaagatggacgagaccgtccagaaggtcaggaagaaacgagaccgattc
aagggcatgacggaagatgaggtcatgagcagaactctgactgacatccttgactacaac
ttggactatgtcattattggaatcaacccaggtctggtggcagcctatgttggacgatgg
ttccctggccctggaaaccatttctggaagtgcctgttcttgtctggattcactgatgag
cagctcaaccacatgagtgacaccagcctgccagcgaaatataagatcggtttcaccaac
atggtggcaaggacaacgcctggaagcaaagacctttcaaccaaagagctacgtgagggt
gccttaattcttgtggaaaagctgaagaagtacaagcctctcatagctgttttcaatgga
aaatgtatctatgaaatgttctgcagagagatgtttggaaaaaagcccaagaagcttgac
tttggtctgcagccacacaagatacctgactgtgaagtggcgttgtatttgatgccgtcg
tccagtgcccgctgtgcccagttcccccgtgcccaggacaaagtgcacttctacatcaag
ctgagggaattaagggaccagctcaggggcgtggccagaacagacgacattcaggagttg
gagtacacctttgacctgggattggccaaggaggacgccaagaggatggcgattaaagag
gaggcgtacgacccgggctacgaggcggcctttggcggcgcatatggcgagggtgggccg
gggcctgaagagggccagagcaacggcaacgggcactgtaacttctcgtcggcggaaaac
acagtttcagacgctgtcgagaaggcagacacttctcaacttcctgccgccgctgccaca
gagggacaactcccggacggacagtggatgatgcagtcttttgctgatcagattccagac
attgggggctctaaagagccccaggcatgggcgggcaatgtataa

DBGET integrated database retrieval system