KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222342
Entry
112222342         CDS       T05605                                 

Definition
(RefSeq) ETS domain-containing protein Elk-3-like isoform X1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112222342
   04012 ErbB signaling pathway
    112222342
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112222342
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112222342
   04912 GnRH signaling pathway
    112222342
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112222342
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    112222342
SSDB
Motif
Pfam: Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 112222342
NCBI-ProteinID: XP_024240895
LinkDB
Position
22
AA seq 544 aa
MESNPLISAMDPSITLWQFLLHLLEDDSHRHLISWTSGDGEFKLLDAEEVARLWGLRKNK
TNMNYDKLSRALRYYYDKNIIKKVSGQKFVYKFVAHPDPSSVDCVRGGEDSQQQENLDAA
GQTKSPGGGSSNCPSKNLQMQRSSPVSVQRSSRNDYMKSGLYSTFTIQSLQAPCRTSPQP
IKTELLNQDSSPRPHSAERTLREVRAHDEDLSILTMVCLDGQSSSMQGCGSVESSLQVTL
THPSPCATPALSPQTLSVSTTGSSKSQPQKTQNLCDPPQIYLTSVSDPGSLTPLTLTPVA
APGAPGECVVNQPQGHPVFVVIKPSHLVHSKEQNLTSEEELVKIMTLGEKHVVEVPESAS
GPREPETPLSIDVLPPCVEPVGQPVGEGEEQGKDEAHLPENSMTPAVALQAATHPAWSPQ
EVQPPKAKKPKVLELPSSSTLLPPGLSLDQVNAAVNSLLAPGSATNTLTPTVFTSHSLTP
VLLTPSPLPSTIHFWSTLSPIAPRSPAKLSFQFPSNGSNHIHIPALSVDGLSTPVVLSPG
PQKP
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggagtctaaccccttaataagtgccatggacccgtccatcacgttgtggcagttcctg
ctgcatctcctcgaggacgacagccataggcacctcatctcctggacctctggggatggg
gagttcaagctgctggacgcagaggaggtggctcgcctctgggggctccgcaagaacaag
accaacatgaactacgataaactaagcagggcgctgcgatactactatgataagaatatc
atcaagaaggtgagtgggcagaagtttgtctacaagtttgtagcccaccctgacccttca
tcagtggactgtgtcagaggcggtgaggattctcagcaacaggagaatcttgatgcagcg
ggccagaccaagtccccaggaggggggtcttctaactgcccctccaagaacctgcagatg
cagcggtcctctccagtctctgtccagcgcagctctcgcaacgactacatgaagtcaggg
ctctactccaccttcaccatccagtccctccaagccccctgcaggacctctccacagcct
ataaagactgagctgctgaatcaggactcttcccccagaccccacagcgctgaacggaca
ctgcgggaggtgagggcccatgacgaggacctctccattttaaccatggtgtgtctggat
ggccagagctcctccatgcagggctgtggcagcgtagagagtagcctgcaggtcacactg
actcatccctcgccctgcgccacgcctgccctcagcccccagaccttgtcagtgtcaacc
acaggcagctcgaagtctcagccacagaagacccagaacctatgcgaccctcctcagatc
tatctgaccagtgtgtcggaccctggctccctcactcctctgaccctgacccctgttgct
gcacctggggccccgggggagtgtgtggtgaaccagcctcagggccaccctgtctttgtg
gtcatcaagccctcacatttggtgcattccaaagagcaaaacctcacgtctgaagaggaa
ctggtgaagatcatgaccttgggggagaaacatgttgtagaggttcctgaatctgcatca
ggaccaagggaacctgaaacccccctctccattgatgtcctcccaccctgcgtggaacca
gtgggccagcctgttggggaaggggaggaacaaggcaaagatgaggctcatttaccagaa
aattccatgactccagcagttgctcttcaagcggctactcatccagcctggtcgccccag
gaagtacaacccccgaaagccaagaagcccaaagtcctagaactgccctcttcctcaacc
ctcctaccccctggtctgtcactggatcaggtcaatgctgccgtcaacagccttctggcc
cctggaagtgccaccaacactctgactcctacagtgttcacctcccattctctgactccg
gtattactgacaccaagtcctctcccctccaccatccacttctggagcacactcagtccc
attgctccccggagcccggccaagctctcctttcagttcccctccaatggaagcaatcat
atccatatccctgccttgagtgtggacggcctgtctactcctgtagtgctgtcgccaggc
ccacagaaaccatga

DBGET integrated database retrieval system