KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222403Help
Entry
112222403         CDS       T05605                                 

Definition
(RefSeq) matrix metalloproteinase-9-like
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:otw01002]
    112222403
Enzymes [BR:otw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     112222403
Peptidases and inhibitors [BR:otw01002]
 Metallo peptidases
  Family M10
   112222403
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Astacin Reprolysin_4 DUF4953 Peptidase_M66 Reprolysin_3
Motif
Other DBs
NCBI-GeneID: 112222403
NCBI-ProteinID: XP_024240966
LinkDB All DBs
Position
22
AA seq 688 aa AA seqDB search
MRSHHRVPVFLVLAMCTVGGWCVPLEKTVSVTFPGDVLKNMTDMELAESYLKRFGYMNVQ
HRSGFQSMVSTSKALMRMQRQMGLEETGTLDKSTVAAMKAPRCGVPDIRSYQTFEGDLKW
DHHDVTYRILNYSPDMEASLIDDAFARAFKVWSDVTPLTFTRLFDGTADIMVSFGKADHG
DGYPFDGKDGLLAHAFPPGEGIQGDAHFDDDENWTLGKGAAVKTSFGNAEGALCHFPFSF
EGKEYSTCTTEGRSDNLPWCATTADYGRDKKFGFCPSELLYTFDGNSNGKECVFPFVFLG
ETYEGCTTEGRSDGYRWCSTTDNFDKDKKYGFCPNRDTAVIGGNSEGEPCQFPFVFLGKK
YDSCTSEGRGDGRLWCATTSDFDADTKWGFCPDRGYSLFLVAAHEFGHALGLDHSNIRDA
LMYPMYSYVEDFSLHEDDVEGIQYLYGSKTGPDPTPPGPTIPTPGPSDEPEPNTPTTTTT
SPTTTHPVDPSQDACQINKFDAITEIDGDLHFFKDGQYWRLSSKTDGGLKGPFSMSERWP
ALPAVIDTAFEDLVTKKIYFFSGTRFWVYTGQSLLGPRSIDKLGLPSTVEKVEGALQRGK
GKVLLFSGENYWRLDVKGQNIDKGYPRFTDIVFGGVPNDAHDVFHFKGHIYFCRDRFYWR
MNSRRQVDRVGYVKYDILKCTDSSNFRY
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgagatctcaccatagagttccggttttcctagtgttggcaatgtgcacggtaggtgga
tggtgcgttcccctggagaaaactgtgtctgtcaccttccctggagatgtcctcaagaac
atgacggatatggagctggcagaaagctacctgaagaggtttggctacatgaacgttcag
caccgcagtggtttccagtctatggtgtccacctccaaggctctgatgagaatgcagagg
cagatggggttggaggagacagggacgctggacaagtctacggtagcagcaatgaaggca
cctcgctgtggggtccctgatatacgctcctaccagacctttgaaggggacctgaaatgg
gatcatcatgatgttacatacaggatcctgaactactctccagacatggaagcttctctg
atagacgacgccttcgccagagccttcaaggtgtggagtgatgtcacccctctcaccttc
acgcgactcttcgacggcaccgctgacatcatggtgtcatttggaaaagcagatcatgga
gatggctaccccttcgatggtaaggacggccttctggcccacgccttcccccctggtgag
ggcatacagggagacgcccactttgacgacgacgaaaactggaccctcggcaaaggagca
gctgtgaagactagctttggcaacgcagagggtgctctgtgccacttccctttttccttc
gagggcaaagagtactccacctgcaccacagaggggcgctctgacaacctgccctggtgt
gccaccacagccgactacggcagagacaagaaattcggcttctgtccaagtgaacttctg
tacactttcgacggaaacagcaacggcaaagaatgtgtgttccccttcgtgttcctgggg
gagacatatgaaggttgcacgacagagggtcgcagtgatggataccgctggtgttccacc
acagacaactttgacaaggataagaagtatggcttctgtcccaacagagatacggctgtg
attggtggaaactctgagggagagccgtgccagttcccctttgtcttcctggggaagaag
tatgactcatgcaccagcgagggacggggagatggcaggctgtggtgcgctaccaccagc
gactttgacgcagacacgaaatggggcttctgcccagataggggctacagtctgttcctg
gttgcggcccacgagtttggtcatgccctgggtctggaccactccaacatcagagacgcc
ctcatgtatcccatgtacagctacgtggaagacttctccctgcatgaagatgatgttgag
ggcattcagtatctctatggatccaagacaggccctgaccccacaccccctgggcccacc
atccctacacctggtcccagcgacgagcctgagcccaacacccccactaccaccactacc
agccccaccactacacaccctgtggacccatcccaggacgcctgccagatcaacaagttc
gacgccatcacagagatcgatggagacctgcacttcttcaaggatgggcaatattggagg
ttgtcaagcaagactgacggtggactgaagggtccgttctccatgtctgagaggtggcca
gctctgccggccgtcattgacacggcctttgaggaccttgtgacaaagaaaatctacttc
ttctcaggcaccaggttctgggtgtatacaggacagagtctcctgggaccccgcagcatt
gacaaactgggtctgccctctactgtagagaaggtggagggagcactgcagagagggaaa
ggcaaggtgctgctcttcagtggagagaactactggaggctggatgtgaagggccagaat
atcgacaagggatatccccgcttcacagacatcgtcttcgggggtgttcccaatgatgct
catgatgtcttccacttcaagggccacatctacttctgtcgggatcgtttctactggcga
atgaactctaggagacaggtagaccgtgtgggatacgtgaagtacgacatcctgaagtgt
accgactcctccaacttccgctactga

DBGET integrated database retrieval system