KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222506
Entry
112222506         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: zyxin-like
  KO
K06273  zyxin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112222506
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 112222506
NCBI-ProteinID: XP_024241044
LinkDB
Position
23
AA seq 501 aa
MDDELASPSPQLCNHTPASDAPPPAFPPPPAVDDLPLPPAPPEENACLPRSPSPLLHHPL
PLSQSLVHSSVPSAGENSQRLEKQTSFDKQLGSLTDLLSEMETRGPFNPKLPSQYSAPPP
PAPKPAGPPPTAPKPSLSFLPPPEMGDKPPPAPWAEELKLRTTHRQANNPTSAPAPAPQP
FAKAPVGASKAFGGMKTGTSVPPVGLKNQNHAPAPFGVAPKPSPVASSFPPPPAAPPAAP
PAAPPAAPPAPPANKVAPPAFNHSKPSSIDSQMTCARPLLPPCPLSAPKRCPRLLGLSLS
QWRCSSLHEGVEELERMTKHSSKDLDTHAPVLTSATSRGIAAIAPAGHAFYDKDGTPQCD
DCYTSSLAVCLFRCGXRITDRVLKAXGQCFHAHCFRCCTCACSLEGAPFITDDNNNPYCV
PDYHRRFSPLCVSCNEPIVPDAGSQETVRVVALDKNFHLKCYRCEDCSRPLSIEADADGC
YPLDGRILCMKCHTQRAKAMQ
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggacgatgagctggccagcccctccccccaattgtgcaaccacactccagcctctgat
gcccctccccctgccttccctccccctcccgcagtggatgacctgcccctcccccccgcc
ccgcctgaggagaatgcctgtctcccccgttccccgtctcccctcctccaccaccccctc
cccctctcccagtctctggtccacagcagtgtccccagtgctggggagaactctcagcgt
ctggaaaagcagactagttttgacaaacagctgggctctctgactgacctgctgtctgag
atggagaccagaggacccttcaaccccaagttgcccagtcagtactcagctcctcctcct
cctgcccccaagcctgcaggtcctccccccactgctcccaagcccagcctctccttcctc
ccccctccagagatgggagacaagccccctcccgctccctgggccgaggagctcaaactc
cggacgacacaccgacaagccaataaccctacatctgccccagctcctgccccacagcca
tttgctaaggcaccagtcggggcttctaaggcttttgggggcatgaaaacggggacgtcc
gtgcctcctgtggggctgaagaaccagaaccacgccccggctccatttggtgttgctcct
aaaccttcccctgtagccagctccttccctcctcctcctgccgctcctcctgccgctcct
cctgccgctcctcctgccgctcctcccgccccaccggccaacaaagtggctcccccagcc
ttcaatcattcaaagccctcttccattgactctcagatgacttgcgcccgccccctcctg
cccccgtgccccctctcagcaccaaagcgatgccctcgcctcctgggcctgtctctgtcc
cagtggaggtgttcctctctccatgagggagtggaggagctggagagaatgaccaagcat
tcatcaaaagacctggacacacacgctcccgtcctcacatccgccacctccagaggtatt
gctgccatcgcccctgcagggcatgcgttctacgacaaggacgggacgccacagtgtgac
gactgctacactagttctctggcggtgtgtttgtttcggtgtgggnagcgtattacagac
cgtgtgttgaaggcgngtgggcagtgtttccatgcccattgtttccgctgctgcacctgc
gcctgcagcctggagggggcgcccttcatcaccgacgacaacaacaacccatactgtgtc
ccagactaccacaggcgtttctctcccctgtgtgtgagctgtaatgagcccatagttcct
gacgccggcagtcaagagaccgtcagagtcgtggccctcgacaagaacttccacctcaag
tgctaccgctgtgaggattgttcccgccccctctccatagaggcggacgcagacggctgc
tacccattggacggcaggatcctgtgcatgaagtgccacacccagcgggccaaggctatg
cagtga

DBGET integrated database retrieval system