KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222667
Entry
112222667         CDS       T05605                                 

Definition
(RefSeq) SHC-transforming protein 1-like
  KO
K06279  SHC-transforming protein 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112222667
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112222667
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112222667
SSDB
Motif
Pfam: PID SH2 PGM_PMM_IV Chordopox_A33R
Other DBs
NCBI-GeneID: 112222667
NCBI-ProteinID: XP_024241158
LinkDB
Position
23
AA seq 395 aa
MGCVEVLQSMRALDFNTRTQVTREAISVVCEAVPGAKGAQRKRKPSSRCMTSILGKRNLQ
FAGMTISLTVSTSSLNLLASDCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRA
CHILECSEGLAQEVISTIGQAFELRFKQYLKNPPKLVTPHDRMAPFDGSAWEEEEDEGAP
PPADVPYYNNFPGKQPPPGGLVDMRARPGATLPYGQPGQNDIHKQPLPPLPMGAKEGGRD
LCDDPSYVNVDKPRPTTAAANGNAHRDAFDMKPFDDSLGVSGLGVSAAPPLVEQLQCEAW
FHGSLSRRQAERLLTRDGDFLVRESGTTPGQYVLTGQQGGQPKHLLLVDPEGVVRTKDHH
FESVSHLISYHMDNRLPIVSAGSEVCLQQPVEHRA
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgggctgtgtggaggtgctacagtctatgagggcgctggacttcaacaccagaactcag
gtcaccagagaggctatctcagtggtgtgtgaggcagtgcctggagccaaaggagcccaa
cgcaagagaaagccgtcgtctcgctgtatgacgtccattctggggaaacgtaacctgcag
tttgctgggatgaccatcagcctgacggtctctaccagcagcctcaacctgctggcctcc
gactgcaaacagataattgcaaatcatcacatgcagtccatctctttcgcttctggagga
gacccagacacagcagagtatgtagcatacgtggccaaagacccagtcaaccagagagcg
tgtcatatcctggagtgttcggagggcttggcccaggaagtcatcagtaccatagggcag
gccttcgaactacgcttcaaacagtacctgaagaacccccccaaactggtcaccccccat
gacaggatggctccgtttgacggctcagcatgggaggaagaggaagatgagggagcaccg
ccccctgcagatgttccgtactataataacttccccgggaaacaacctcctcctggggga
ctggtggacatgagggcccgccctggggctacgctgccctatggacagccgggtcagaat
gatattcacaagcagccgcttccccctctaccaatgggagcaaaggagggagggcgggac
ctgtgtgatgacccttcatacgtcaatgtggataaaccccgccccacaacagctgcagcc
aatggcaatgctcacagagatgcgttcgacatgaagccatttgatgattccctgggtgta
tcaggtctgggggtctcagcggcgccccctctggtggaacagctgcagtgcgaggcctgg
ttccacggcagcctgagtcgcaggcaggctgagagactgctgacccgtgacggagacttc
ctggtccgagagtcaggcaccacccctggacagtacgtcctcactggacaacaggggggt
cagcccaaacacctactactggtcgacccagagggagtggtacgtaccaaagaccaccac
tttgagagtgtgagccacctgatcagttaccacatggacaacagactgcccatcgtatca
gcaggcagtgaagtgtgtctgcaacaaccagtggagcacagggcctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112235421
Entry
112235421         CDS       T05605                                 

Definition
(RefSeq) SHC-transforming protein 2-like isoform X1
  KO
K17447  SHC-transforming protein 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112235421
   04370 VEGF signaling pathway
    112235421
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112235421
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112235421
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 112235421
NCBI-ProteinID: XP_024259672
LinkDB
Position
1
AA seq 808 aa
MTSPRERESGGACKRARAREKLRCREAGESVCEWESTGQYSLNIDRGYSSFQKILQIFFP
PLFHCTSPPPPFPFPSSSVNPSQPLLQAAPPGMLLKPKYGRFRNASVTSSDDLMQSLAMS
GKVVATPVVLSSAPSLPLPPLPPLESIPGSSSAAPALADSPCLDGEQDATTTFCMLIPRM
PQWKFSNTLLSRSPSNSSSSSSSSKDSGKTAAPSSQGSHGPSGPSAPSGPVASLAAVLNS
CDPVCVTPCSLQAISRQRSAMRSASPGGHGAGAAEGTGSLGGHNGFRTGMNRRTRVEGMW
LGGEDFNQKGSFIHKPSQGWLHPDKNITGPGASYIVRYMGCIEVLKSMRSLDFNTRTQVT
REAINRLCEAVPGSKGAWRKKNINKALQTIMGKSNLRFAGMGIAVNISIEGLNLLIPTTR
QVIAHHPMESISFASGGDTDTPDYVAYVAKDPVNQRACHILECGDGLAQNVISTIGQAFE
LQFKQYLHSPPKAIPTMERNIRTEDSAWGDDEDSSEHDYYNSIPGKEPPVGGVVDSRLRP
CTALLGHVHSQPQSKAAQIGSPARRDTVSYPSGQLCYELHWDTENGSSGLTSDGYLRADG
HPPGSRDYEEHLYVNTQSLEGLEQGAEGHRGARGPDSPKKDIFDMKPFEDALKMHEAGGN
GGVCVLEDQWPSPPRRRAPVAPTEEQLRREAWYHGRMSRRDAEKLLVRDGDFLVRDSATN
PGQYVLTGMHCGLPKHLLLVDPEGMPTPPRHCQVRTKDMLFDSISHLISYHLKNELPIVA
AESELHLKQVVRRKEGTAFWNGVRGVSI
NT seq 2427 nt   +upstreamnt  +downstreamnt
atgacatcacccagagagagagagagtgggggtgcgtgcaagcgagccagagcaagggag
aagctcagatgcagagaggcaggagagagcgtgtgtgagtgggagagcactggacagtac
tcactcaacattgacaggggatacagctctttccagaagattttgcagatttttttcccc
cctctcttccattgcacctctccccctccccctttccccttcccctcatcctctgtcaac
ccctctcagcctttgcttcaggctgctcctccgggcatgctacttaagccaaagtatggc
cgctttcgcaacgcctctgtgacctcctccgacgacctgatgcagagcttagccatgagc
ggaaaagtggtggccacccctgtggtcctctcctccgcccccagcctgccgctgcccccc
ctgcctcctctggagtccatccccgggtcctcctccgcagccccggccctagccgactcc
ccctgcctggacggggagcaggacgccaccaccactttctgcatgctcatccccaggatg
cctcagtggaagttctccaacactctgctgagcaggagcccctccaactccagctccagc
tccagctcaagcaaggactccggcaagactgcagccccctcatcgcagggctcgcacggc
cccagtggcccttcggcccccagtggtcccgtggcaagtctggctgctgttttgaactcc
tgtgaccctgtgtgtgtcaccccctgttccctacaggccatcagcaggcagagatctgca
atgcgctcagccagtccagggggccatggagcaggggctgcagagggcacagggagcctt
gggggccacaacggcttcaggacagggatgaaccgcaggaccagggtggagggcatgtgg
ctgggaggggaggacttcaaccagaagggcagcttcatccacaagccctcccagggatgg
ctgcacccagacaagaatatcacaggccctggggcctcctacattgtcaggtacatgggc
tgcattgaggtgttgaagtcgatgcgatcgctggacttcaacactcggacccaggtgacg
agggaggccatcaacagactgtgtgaagctgtgcctgggagtaagggggcctggaggaag
aagaacattaacaaggccctgcagaccatcatggggaagagtaacctgcgcttcgctggt
atgggcatcgctgtcaacatctctatagagggcctcaacctgctcatccccacgacacga
caggtgatagcacaccatcccatggagtccatctcctttgcctctgggggagacacggac
acgccggattatgttgcttatgtggccaaagatccagtcaatcagagagcatgccatatc
ctggagtgtggtgacggtctagcccagaatgtcatcagtaccatcggccaggcctttgaa
ctgcagtttaaacagtacctccacagccctcccaaagccatccccaccatggagaggaac
atcaggacagaggactcggcgtggggtgatgacgaggactcctcggagcatgactactac
aacagcatcccagggaaggagcctcctgttggaggagtggtggactcgaggctgaggcct
tgtacggccttgctgggccacgtccacagccaaccacagagcaaggcagcgcagatcggt
tctccggccaggagagacacagtgtcctacccctcaggtcagctgtgctacgagcttcac
tgggacactgagaacggcagctcaggtctgacatcagatgggtacttgcgggcagacggc
catcccccgggaagtagggactatgaagagcacctgtatgtgaacacccagagtctggag
ggcctggagcagggagcagagggccataggggggccagggggccagacagccccaagaaa
gacatctttgacatgaaaccctttgaggatgctctgaagatgcacgaggccggtggtaac
ggtggggtgtgtgtgctggaggatcagtggcccagtccgccccggcgtcgtgcccctgtc
gcccccacagaggagcagcttcggcgggaggcctggtaccatggccgtatgagccgccgg
gacgctgagaaactgctggtccgagacggggacttccttgtacgagacagtgccaccaac
ccaggccagtacgtcctgacaggcatgcactgcggtctgcccaaacacctgctactggtc
gacccagagggaatgcccactcctcctcgtcactgccaggtacgaaccaaagacatgctg
tttgacagtatcagtcacctgatcagctaccacctgaagaacgagctgcccatcgtggca
gccgagagcgaactgcacctcaaacaggtggtccggaggaaagaggggacagcgttctgg
aatggagtcagaggtgtgtctatataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250883
Entry
112250883         CDS       T05605                                 

Definition
(RefSeq) SHC-transforming protein 2-like isoform X1
  KO
K17447  SHC-transforming protein 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112250883
   04370 VEGF signaling pathway
    112250883
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112250883
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112250883
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 112250883
NCBI-ProteinID: XP_024277168
LinkDB
Position
5
AA seq 703 aa
MLLKPKYGRFRNDSVTSSDDLMQSLAMSGKVVATPVVLSSAPNLPLPPLPPLESIPRSSS
AAPALADSPCLDGEQDATTTFCMLIPRMPQWKFSNSLLSRSPSNSSSSKDSGKAAAPSSQ
GSHCPSGTSAPNGPVASLASVLNSCDPVCVNPCSLQAISRHRSAAGSASPGGHSAGATEC
TGSPGGHSGSRTGMNRRTRVEGMWLGGEDFNQKGSFIHKPSQGWLHPDKKITGPGASYIV
RYMGCIEVLKSMRSLDFNTRTQVTREAINRLCEAVPGGKGAWRRKNINKALQSVMGKSNL
RFAGMSIAVNISIEGLSLLIPTTRQVIAHHPMQSISFASGGDTDTPDYVAYVAKDPVNQR
ACHILECCDGLAQNVISTIGQAFELQFKQYLHSPPKAIPTVERNIRTEDSAWGDDEDSLE
HDYYNSIPGKVPPFGGVVDSRLKPCTALLGHIHSQPESKAVQMGSPSRRETASCPSGQLC
YELHWDTENNGSSGLTSDGYQRADGQTPGSRDYEEHLYVNTQSLEGLEQGAEGHRGARGP
DSPMKDIFDMRPFEDALKMHEAGGVSGNGGVCVLKNQWPSPPRRRAPVAPTEEQLRREAW
YHGRMSRRDAEKLLVRDGDFLVRDSATNPGQYVLTGMHCGLPKHLLLVDPEGVPTPPRHC
QVRTKDMLFESISHLISYHLKNELPIVAAESELHLKQVVRRKQ
NT seq 2112 nt   +upstreamnt  +downstreamnt
atgctacttaaaccaaagtatggccgctttcgcaacgactctgtgacctcctccgacgac
ctgatgcagagcttagctatgagcggcaaagtggtggccaccccggtggtcctctcctcc
gcccccaacctgccgctgccccccctgcctcctctggagtccatcccccggtcctcctcc
gcagcccctgctctggccgactccccctgcctggatggggagcaggacgccaccaccact
ttctgcatgctcatccccaggatgcctcagtggaagttctctaactcgctgctcagcagg
agcccctccaactccagctccagcaaggactcgggcaaggctgcagccccctcatcgcag
ggctcgcactgccccagtggaacttctgcccccaacggtcccgtggccagtctggcttct
gttttgaactcctgtgaccctgtgtgtgtcaacccctgttccctacaggccatcagcagg
cacagatctgcagcgggctcagccagtccaggcggccacagcgcaggggctacagagtgc
acagggagccccgggggccacagcggatccaggacggggatgaaccgcaggacaagggtg
gagggcatgtggctgggaggggaggacttcaaccagaagggcagcttcatccacaagccc
tcccagggctggctgcacccagacaagaagatcacaggccctggggcttcctacatagtc
aggtacatgggctgcattgaggtgttaaagtcgatgcgatcgctggactttaacactcgg
acccaggtgacgagggaggccatcaacagactgtgtgaagctgtgcctgggggtaaaggg
gcctggaggaggaagaacattaacaaggccctgcagtccgtcatggggaagagtaacctt
cgcttcgctggtatgagcatcgctgtcaacatctctatagagggtctcagcttgctcatc
cccaccacacgacaggtgatagcacaccatcccatgcagtccatctcctttgcctctggg
ggagacacggacacgcccgattatgttgcttatgtggccaaagatccagtcaatcagaga
gcatgccatatcctggagtgttgtgacggtttagctcagaatgtcatcagcaccatcggg
caggccttcgaactgcagtttaaacagtacctccacagccctcccaaagccatccccacc
gtggaaaggaacatcaggacagaagactcggcgtggggagatgacgaggactcgttggag
cacgactactacaacagcatccctgggaaggtgcctccttttgggggagtggtggactca
aggctgaagccttgtacggccttgctgggccacatccacagccaaccagagagcaaggca
gtgcagatgggttctccgtccaggagagagacagcttcctgcccttcaggtcagctgtgc
tatgagcttcactgggatactgaaaacaatggcagctcaggtctgacatcagatggttac
cagcgggcagacggtcagactccggggagcagggactatgaggagcacctatatgtgaac
acccagagtctggagggattggagcagggagcagagggccacaggggggccagggggcca
gacagccccatgaaagacatctttgacatgagaccctttgaggatgctctaaagatgcac
gaggctggtggtgtcagtggtaacggtggggtgtgtgttttgaagaaccagtggcccagc
ccgccccgacgtcgtgcccctgtcgcccctacagaggagcagctccggcgggaggcctgg
taccacggtcgtatgagccgccgtgatgctgagaaactgctggtccgagacggggacttc
ctggtacgagacagtgccaccaacccaggccagtatgtcctgacaggcatgcactgtggt
ctgcccaaacacctgctactggtggacccagagggagtgcccactcctcctcgtcactgt
caggtacgcaccaaagacatgctgtttgagagcattagtcacctgatcagctaccacctg
aagaacgagctgcccatcgtggcggccgagagcgagctgcatctcaaacaggtggtccgg
aggaaacagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112257355
Entry
112257355         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: SHC-transforming protein 3-like
  KO
K17448  SHC-transforming protein 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112257355
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112257355
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112257355
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 112257355
NCBI-ProteinID: XP_024286625
LinkDB
Position
9
AA seq 703 aa
MLHRTKYNRFRNESVTSVDDLHGLTMNPKVSAAPASSAEPPYTPPAAPSEGGVNHHHPAA
DPSDDGATTLCTLINKVSNLKFTNSGSSLLGIKSLPSHVKDLTLSKLQGAGGSGGGSSCI
GSGSGPSVSLAASGGGNGGGGNGSSCGSASSISHHHHPPCSHSHSSQQEPGTMSNAGGKK
GSRLGLEEREAGQRQGHGGEDWGPSGGGGNSGLVNKPCSRGWLHSSEKISGPGVTYIVKY
LGCIEVLRSMKSLDFNTRSQITREAISLVCEAVPGAKGALRKRKPPSKALSSILGKSNLQ
FAGMSINLNISPSSLNLMTPDSKQIIANHHMQSISFASGGDPVSDPDTTHYVAYVAKDPV
NRRACHILECCDGLAQDVXSTIGQAFDLRFQQYLQCPSSKXPLYTTLIDLLCDDRVLNME
SVWTEEEEEEPAEHPYYNNIPGKMPPPGGFIDTRLGQSIQAEQAPGAGVDQTYYQGRHCG
EIWGADRRPTGILVQQGSCDIYSLPEGKSTVPKTGDVPTYVNTQQIDAQVLAALQAEQDS
MAAEGAAGTAAKESPRKDLFDMKPFEDAILTQSAVPALHKAGSVDNSSPLLVRSAAFKAQ
EELEGQAWYHGEMSRRDAEKLLVDDGDFLVRKSTTNPGSYVLTGMHNGLAKHLLLVNPEG
TVRTKDHIFDSISHLIGHHRDNSLPIVSAGSELCLKQPVGNRK
NT seq 2112 nt   +upstreamnt  +downstreamnt
atgcttcaccgtaccaaatacaacagattcaggaatgagtcggtgacgtccgtcgatgat
ctacacggcctcaccatgaaccccaaggtctcggcagcccctgcgtcctccgccgagccc
ccgtacacccctcctgcagcgccatccgagggcggcgtgaaccaccaccaccccgctgcc
gacccctcagacgatggagccaccaccctgtgcaccctcatcaacaaggtgtccaacctg
aagttcaccaactcaggctccagcctgctgggtatcaagagcctcccctcccacgtcaag
gacctgaccctctccaagctgcaaggtgctggaggctctggtggtggatccagctgcatt
ggtagcggctctggccccagtgtgtcgttggcagcctccggtggcggtaacggtggtggt
ggtaacggctcctcctgtggctcagcctccagcatctcccaccaccaccaccctccctgc
tcccactcccactcctcccagcaagagccaggcaccatgagcaacgcagggggaaagaag
ggcagcaggttggggctggaagagagggaggctgggcagagacagggacatggaggggag
gactggggacctagtggaggaggaggtaacagtggactggtgaataaaccctgttccaga
ggatggctgcattccagtgagaagatctctggacccggagtgacgtacattgtaaagtat
ttgggttgcattgaagtccttcggtcgatgaaatcactggatttcaacacgagatcgcaa
ataacaagagaggccatcagcttggtgtgtgaggcagtcccgggggccaaaggagcgctg
cggaagagaaagcctccatctaaagccctgtccagcatcttggggaagagtaaccttcag
tttgctgggatgagcatcaatttgaatatctcccccagcagcctcaacctgatgacccca
gactccaaacagatcatagccaatcatcatatgcagtccatttcctttgcatcaggagga
gatccagtgagtgatccagacacgactcattatgttgcctatgtagcaaaagatcctgtc
aaccgaagagcgtgtcatattctggagtgttgtgatggtctggcccaggatgtgntcagc
accatcggccaggcctttgacctccgtttccagcagtacctccagtgtccctccagcaag
tgacctctgtacacgacgctgatcgaccttctgtgtgatgacagggttctgaatatggag
tcagtctggacagaggaggaggaggaggagcctgccgaacatccgtactacaacaatatc
cccggaaagatgccaccacctggaggattcatagacacccggctaggccagagcatccag
gctgagcaggccccaggggctggggtggaccagacttactaccagggtagacactgtggt
gagatctggggagcggacaggaggcctactgggatactcgtccaacagggatcatgtgac
atctacagtctgccggaggggaagagtacagtaccaaaaacgggggatgtgcctacgtac
gtgaacacccagcagatcgacgcccaggtgctggcagccctgcaggctgaacaggacagc
atggcagcagaaggggcagcggggacagcagccaaagaaagtccaaggaaagacctgttc
gacatgaagccttttgaggatgccatcctgacccagtcagcggtccctgcccttcacaag
gctggatctgtggataactccagccccttgttggtgcgctctgctgccttcaaggcccag
gaggagctggaaggccaggcctggtaccacggcgagatgagccgacgagacgcagagaaa
ctactggtagatgacggagacttcctggttaggaagagcaccaccaaccctgggtcgtac
gttctaacgggcatgcacaatggactggccaaacacctactgctggtgaatcctgagggc
acggtgcggacaaaagatcacatatttgacagcatcagtcacctgataggccatcaccgt
gacaacagcttgcccatagtgtctgcaggaagtgaactttgtctgaagcagcctgtgggc
aacaggaaatag

DBGET integrated database retrieval system