KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222767Help
Entry
112222767         CDS       T05605                                 

Definition
(RefSeq) trypsin-3
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112222767
Enzymes [BR:otw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     112222767
Peptidases [BR:otw01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   112222767
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112222767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 112222767
NCBI-ProteinID: XP_024241279
LinkDB All DBs
Position
23
AA seq 247 aa AA seqDB search
MKVIILLALFAVAFAAPIDDEDDKIVGGYECRKNSASYQASLQSGYHFCGGSLISSTWVV
SAAHCYKSRIQVRLGEHNIAVNEGTEQFIDSVKVIMHPSYNSRNLDNDIMLIKLSRPASL
NSYVSTVALPSSCASSGIRCLVSGWGNLSGSSSNYPDTLRCLDLPILSSSSCNSAYPGQI
TSNMFCAGFMEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNKPGVYTKVCNYKSWI
SSTMSSN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcatcattcttctcgctctgttcgctgtggcattcgctgcccccattgacgat
gaggatgacaagattgttggagggtacgagtgcagaaagaactctgcatcctaccaggca
tcactgcagtctggctaccacttctgtggtggctccctgatctccagcacatgggtggtg
tctgctgctcactgctacaagtcccgcatccaggtgcgtctgggtgagcacaacattgcc
gtcaacgagggcactgagcagttcatcgactcagtaaaggtcatcatgcaccccagttac
aacagccgcaacctggacaatgacatcatgctgatcaagctgagcaggcccgcctccctg
aacagctatgtgagcactgtggctctgccctccagctgtgccagctctggcatccgctgt
ctggtctctggctggggcaacctatccggcagcagcagcaactaccctgacactctgagg
tgcctggatctccccatcctgagcagcagcagctgcaacagcgcctatcctggacagatc
acctccaacatgttctgtgctggcttcatggagggaggcaaggactcttgccagggagac
tccggtggccccgtggtgtgcaatggtcagctgcagggtgttgtgtcctggggttacggc
tgtgcccagaggaacaagcctggtgtctacaccaaggtctgcaactacaaatcctggatc
agcagcaccatgtcctccaactaa

DBGET integrated database retrieval system