KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223208
Entry
112223208         CDS       T05605                                 

Definition
(RefSeq) calpain-2 catalytic subunit-like
  KO
K03853  calpain-2 [EC:3.4.22.53]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04218  Cellular senescence
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112223208
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112223208
   04217 Necroptosis
    112223208
   04218 Cellular senescence
    112223208
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112223208
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:otw01002]
    112223208
Enzymes [BR:otw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.53  calpain-2
     112223208
Peptidases and inhibitors [BR:otw01002]
 Cysteine peptidases
  Family C2: calpain family
   112223208
SSDB
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_6 EF-hand_1 EF-hand_7
Other DBs
NCBI-GeneID: 112223208
NCBI-ProteinID: XP_024242010
LinkDB
Position
24
AA seq 686 aa
MTSMAGRLARQQERENGVGTNQQAVKYLQQDYETLLQGCLESGKLFQDPSFPAESKSLGY
KELGKYSSKTKGLMWKRPTELCSNPKFIDDGATRTDICQGDLGDCWLLAAIASLTLDERV
LARVVPPEQSFTDRYAGIFHFQFWQFGEWVDVVIDDRLPTRDGKLLFVHSAEGSEFWSAL
LEKAYAKVNGCYESLSGGSTIEGFEDFTGGIAEIYQLDKAPPHLFKIMEKALGLGSLLGC
SIDITNSYETEAVTALKLVKGHAYSVTGAEEVHLHGDPVQLIRIRNPWGQVEWTGPWSDG
WMSYSDFIRQFSKLEICNLTPDTLASDEVGHWNNYQYKGMWRVGSTAGGCRNHPATFCSN
PQFLVCLEDVDDDPLDGVDGCTFLVGLMQKDGRRNRQMGEDLSAVGFAIYAVPDEYKGQS
NIHLGPDVLLRQKHVAMSSTFINTREVCDRFCLPPGEYVIIPSTFQPHKNGSFILRVFSE
KHAATSEMGSVPAEEVKEIKVAEKDVDPNFKHMFKQIAGSDGEVTVFQLVEILNKVFAKR
ADIKTEGFSLETGRHIVSLLDKDGNSKLGLVEFHMLWMKIQKYLEIFKSYDSDRSGTMSS
HEMRGARQKSGFHINSAVLQVIVNRYASAHYAIDFHCFVDCLIRVEMLFKMFKTLDTNAS
GKIELDVSQWLCLANQLDFPKPGGIN
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgacgtctatggcaggtcggctggcccgtcagcaggagagggaaaacggtgttggaacc
aaccagcaggcggtaaagtacctccaacaggactatgaaacgctgcttcagggctgtctg
gagtccgggaagctgttccaggacccctccttcccagcagagagcaagtctctagggtac
aaagagctggggaagtactcatccaagaccaaggggctgatgtggaagagacccacggag
ttgtgctcaaaccccaaattcattgacgatggagccaccaggactgatatctgccaagga
gatctgggggactgttggctgctggctgctattgcatcactgaccctggacgagagagtg
ctggccagggtcgttcctcctgaacagagcttcactgaccgctacgctggcatctttcac
ttccagttctggcagtttggtgagtgggtggacgtggtgattgacgaccggctgcccacc
agagatggaaagctgctgtttgttcactcagccgagggctctgagttctggagcgccctg
ctggagaaggcctacgccaaggtgaatggatgctatgagtctctgtcaggtggctccacc
atcgaggggtttgaggacttcacaggagggatagcagagatataccagttggacaaagct
cctcctcacctcttcaagatcatggagaaggctctgggcctgggctctctactgggctgt
tccattgatatcaccaattcctatgagacagaggcagtgacagctcttaaactggtgaag
ggacacgcatactctgtcaccggtgctgaagaggtccatctccatggagacccggtccag
ctgattcgcatcaggaacccctggggacaggtggagtggactgggccctggagtgatggg
tggatgtcctattcagactttatacgtcagttctccaagctggagatctgtaacctgact
ccggacaccctggccagtgacgaggtgggccactggaacaactaccagtataaaggcatg
tggcgggtagggtctaccgctggaggctgcaggaaccatccagccacgttctgctccaac
ccccagttcctggtgtgtctggaggatgtggacgatgatccactggatggtgtggatggc
tgcactttcctggtgggcctgatgcagaaagacggacggcgcaaccgccagatgggagaa
gacctcagtgccgtcgggttcgctatctatgcggttcctgatgagtataagggtcaatct
aacatccacctgggaccagatgtgctgttgagacagaaacacgtggccatgagcagcacc
ttcattaacaccagagaggtgtgtgaccgtttctgccttccccctggggagtatgtcatc
atcccctccaccttccagcctcacaagaacggcagcttcatcctcagagtgttctcggag
aaacacgcagccaccagtgaaatgggatcggtgcctgctgaagaggtaaaggagattaaa
gtggcagagaaagatgtggatcccaatttcaagcatatgttcaagcagatcgccggcagt
gacggagaagtgactgtcttccaacttgttgaaattctgaacaaagttttcgctaaaagg
gccgacatcaagacggaaggttttagtcttgaaactggacgacacattgtcagtcttcta
gataaagatggaaattccaagttgggactggttgaattccacatgctttggatgaagatc
cagaaatacttggaaattttcaagagttatgactcagaccgctctggaactatgagttca
catgagatgagaggtgctcgacagaagtcaggcttccacatcaacagtgcagtgctgcag
gtcatagtgaatcgttatgccagcgcccactatgccatcgactttcactgtttcgtggac
tgtctcatcagagttgaaatgctcttcaagatgtttaaaactctggataccaacgcctct
gggaagattgagttggatgtgtcccaatggctgtgcctggcaaatcaactagacttccca
aagccaggaggaatcaactag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112266430
Entry
112266430         CDS       T05605                                 

Definition
(RefSeq) calpain-2 catalytic subunit-like
  KO
K03853  calpain-2 [EC:3.4.22.53]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04218  Cellular senescence
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112266430
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112266430
   04217 Necroptosis
    112266430
   04218 Cellular senescence
    112266430
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112266430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:otw01002]
    112266430
Enzymes [BR:otw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.53  calpain-2
     112266430
Peptidases and inhibitors [BR:otw01002]
 Cysteine peptidases
  Family C2: calpain family
   112266430
SSDB
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_8
Other DBs
NCBI-GeneID: 112266430
NCBI-ProteinID: XP_024299662
LinkDB
Position
2
AA seq 700 aa
MSSIANHLARRKAREEGEGSNDKAIPFNKQDFQTLRRECLESGKLFSDTSFPADWNSLGY
NELGRYSSKTRGVEWKRPKELCSNPQFIVEGATRTDICQGALGDCWLLAALASLTLDKDI
LARVVPPGQSFEENYAGIFHFQFWQYGQWVDVVIDDRLPTREGKLLFVHSAEGSEYWSAL
LEKAYAKVNSSYEALSGGSTTEGFEDFTGGIAETYNLGKAPQCLFKIMKKALGLGSLLGC
SIDITSAYETEAVTGQKLVKGHAYSITAAEEVHLHGTPVELVRIRNPWGQVEWTGAWSDD
SREWDGVRPEEKSKLDHSAEDGEFWMAYSDFLRQYSKLEICNLTPDTLVSDEVGRWNHYQ
FEGMWRVGSTAGGCRNHAATFCSNPQFAIKLDDVDDDPHDGKDGCTFLVGLMQKDGRKER
RFSRDLNTIGFSIYQVPDEYKGRTNIHLGPDVLLRQKSVAMSNTFINLREICDRFKLPPG
EYVIIPSTFEPHKKGSFLLRVFAEKHAATSPMEEDISVEVDEPDITEGDVDPYFKRLFLQ
IAGSDSEVSAFELQKILNRVVTQRSHVKTDGFSLETCRHIISLLDMDGNAKLGLVEFHTV
WTKIQKYLEIFKSHDSDNSGTMSTHEMREALTEAGFQLNSEVLQLIVSRYANSEYSMDFD
CFMGCLIRLEMLFKMFKTLDKHDSGKIELDALQWVCLGLN
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgtccagtatagctaaccacttggccaggaggaaagctagggaggaaggtgaaggtagc
aacgacaaggccatcccctttaacaagcaagacttccagaccctgaggagagagtgtctg
gagagcgggaaactcttcagtgacacatccttccctgctgattggaactctcttgggtac
aatgagttgggtcgctactcttcaaaaacccggggcgttgagtggaaaagaccaaaggag
ttgtgctcaaaccctcagttcattgttgaaggagccacgagaactgacatctgccaaggg
gctttgggtgactgttggttgctggcagcccttgcctctcttaccttggacaaagacatc
ttggctcgagtggtaccccctgggcagagctttgaggagaattatgctggcatctttcac
ttccagttttggcagtatggacagtgggtggatgttgtgattgacgataggctgcccaca
agagaggggaaactgctgtttgttcactcagctgagggctcagagtattggagcgccctg
ctggagaaggcctatgctaaagtcaacagttcctatgaggccttgtctgggggctccacc
acagaaggctttgaggacttcactgggggcatcgctgagacatataatcttggcaaggcc
ccacagtgcctgttcaaaatcatgaagaaggccctggggctgggttctcttttgggctgc
tccattgatataacaagtgcgtacgagacggaggcagtcactggtcagaagctggtgaag
gggcatgcatactcaatcactgcagcagaagaggtacacctgcatgggactccagttgag
ctggtgaggatcagaaacccctggggtcaggtggagtggacgggtgcctggagcgatgat
tccagggaatgggatggagtacgaccggaggagaaatccaagctcgaccactctgcagaa
gatggagagttttggatggcctactctgatttcctaaggcagtactccaagctggagatc
tgcaacctgactccagacacgctggtcagtgatgaagtgggtcgctggaaccactaccag
tttgaggggatgtggagggtaggctctaccgctggaggatgcaggaaccatgcagccaca
ttctgctctaacccccagtttgccattaaattggatgatgtggatgatgaccctcatgat
ggcaaggatggctgcaccttcttggtgggcctcatgcaaaaagacggccgcaaagagagg
agattcagccgggacctcaacaccattggcttttcaatataccaggttcctgatgagtat
aagggccgcaccaacatccacctgggcccagatgtgctgctgagacagaagtctgtggca
atgagcaataccttcatcaacctgcgggagatctgtgaccgcttcaagttgccccccggg
gagtacgtcatcatcccctccacgtttgagccgcacaagaagggcagcttcctcttgaga
gtcttcgccgagaagcatgctgccaccagtccaatggaagaggatatcagtgtggaagtt
gacgagcctgatattacagagggtgatgtggatccctacttcaaacgtctattcttgcag
attgctggaagcgattccgaagtttctgcctttgaacttcaaaagattttaaacagagtg
gtaactcagagatctcacgtcaaaactgatggatttagcctcgagacctgtcgtcacatc
atcagtctgttggatatggatggcaatgcaaagttgggcctggttgagttccatactgtg
tggactaagatccagaagtatttggaaatcttcaaaagtcacgactctgacaactctggc
acgatgagcacccacgagatgagggaggcgttgactgaagcaggatttcagcttaacagc
gaggtgctccagctaattgtgtcccgctacgctaactcagagtactccatggactttgac
tgcttcatgggctgcctgatacgactggaaatgctatttaaaatgttcaaaacacttgac
aaacatgacagtgggaagatcgaattggatgcattgcagtgggtctgcctgggcctcaat
taa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112266436
Entry
112266436         CDS       T05605                                 

Definition
(RefSeq) calpain-2 catalytic subunit-like
  KO
K03853  calpain-2 [EC:3.4.22.53]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04218  Cellular senescence
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112266436
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112266436
   04217 Necroptosis
    112266436
   04218 Cellular senescence
    112266436
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112266436
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:otw01002]
    112266436
Enzymes [BR:otw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.53  calpain-2
     112266436
Peptidases and inhibitors [BR:otw01002]
 Cysteine peptidases
  Family C2: calpain family
   112266436
SSDB
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_8 EF-hand_1
Other DBs
NCBI-GeneID: 112266436
NCBI-ProteinID: XP_024299675
LinkDB
Position
2
AA seq 698 aa
MSGMASNLAKKRALAAGFGTNANAVKYLNQDFEALRAQCLNRGGLFSDPTFPAAPESLGF
NELGPGSYKTRAVQWKRPGELCSSPEFIVGGATRTDICQGALGDCWLLAAIASLTLNEDV
MARVVPVGQSFGESYAGIFHFQFWQFGEWVDVVIDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKVNGCYEALSGGSTTEGFEDFTGGIAENYDLRKPPPNMFQIIKKAIESGALLGC
SIDITSAADSEAVTRQKLVKGHAYSLTGAVEVTYRGRKEKLIRIRNPWGQVEWTGAWSDS
SSEWNSVDDSERQNVKADDGEFWMSFTEFLRHYSRIEICTLTPDTLTDDSVKHWSVCNYD
GSWRKGSTAGGCRNHAYTFWMNPQFVIRLDEEDDDPDDNEVGCSFVVGLIQKNRRRLRKV
GEDMHTIGFAIYEVPSQFHGQREVHLDKNYFLTHAQKARSETFVNLREVSTRFKMPPGEY
LIVPSTFEPHLNGDFCIRVFSEKQTETRPCDDPVKADLDDETVSDAEVDAGFRGLFTKLA
GDDMEISAAELKTIMNKIVSKRTDIKTDGFSLETCRIMVNLMDDSGNGKLGLGEFATLWK
KVQKYLGIYKKNDMDNSGTMSTPEMRMALKEAGFTLNNGIYQILVARYAEPDMTIDFDNF
VACLMRLDMMFRVFMKIDAHDSGSIELDFHQWLTFTMI
NT seq 2097 nt   +upstreamnt  +downstreamnt
atgtctggaatggcgtctaacctagctaaaaagcgggcattggctgcagggtttggcact
aatgctaatgcggtgaaatatctcaatcaggattttgaagcgcttagggcgcaatgttta
aatcgaggagggctgttctcggatccaactttcccagccgcacccgaatctttgggcttt
aatgaactcggaccaggctcgtacaaaactagagcagtgcaatggaaaaggccaggagag
ttgtgctcaagtccagagttcattgttggaggagccaccagaacagatatctgtcaagga
gctctaggtgactgttggcttttagctgccattgcctctttgacactcaatgaagatgtc
atggctagagtggtccccgttggacagagctttggggaaagttacgctggcatttttcat
tttcagttttggcagtttggggagtgggtggatgttgtcattgatgacaggctgcccaca
aaagatggagagctgctgtttgttcactcagctgagggctcagagttctggagtgcactg
ctggagaaggcctacgctaaggtgaatggctgctacgaggccctgtctgggggctccacc
actgagggctttgaggacttcactgggggcattgcagagaactacgacctgaggaaaccc
cctccgaacatgttccagattattaagaaggcaattgagtcaggggctctgcttggctgc
tccattgacataaccagcgccgctgattctgaggcagtcacacgacagaagctggtgaaa
gggcatgcctactccctaacaggggctgttgaggtgacctatcgtggccgtaaggagaag
ctgatcaggatacgtaacccttggggtcaagtggagtggacaggggcttggagtgacagc
tcctcagagtggaactccgttgatgattcagagcgccagaacgtcaaagctgatgatgga
gaattctggatgtcatttacagagttcctgcggcattactctcgcatagagatttgcact
ctgaccccagatacactaacggatgactctgtgaagcactggagtgtgtgtaactatgat
ggtagctggaggaagggttccactgctggggggtgcaggaaccacgcctacaccttctgg
atgaacccccagtttgtgatcaggctggatgaggaggacgatgaccctgatgataacgag
gtgggctgcagcttcgtggtgggcctgatccagaagaaccggcgccggctgaggaaagta
ggcgaagacatgcacaccattggctttgccatctatgaggttccatcacagtttcatggt
cagagggaggttcacctggacaagaattatttcctgacacatgctcaaaaggcccggtct
gagaccttcgtcaaccttcgggaggttagcacccgcttcaaaatgccccctggggagtac
ctcattgtgccctccaccttcgagccgcacctaaatggtgacttctgcatccgtgttttc
tcagagaagcagactgagactcgaccatgtgacgatcctgtcaaggcagacttagatgat
gagactgtatctgatgctgaagtcgacgcaggatttagaggcttgtttacaaagcttgca
ggagatgacatggagatctctgcagcagagctgaaaaccatcatgaataagattgtctcc
aaacgaactgacatcaaaacagatggcttcagtcttgaaacctgtagaatcatggtcaac
ctcatggatgacagtgggaatggaaaattgggccttggggaattcgctactctgtggaag
aaagtgcagaaatacctgggtatctataagaagaatgacatggacaattcaggcaccatg
agtactccagagatgcgtatggccctgaaagaagcaggcttcactttgaacaatggcatt
tatcagatcctcgtggctcgctacgctgagccagacatgaccatcgactttgataacttt
gtggcctgccttatgcgtctggatatgatgttcagagtctttatgaagattgatgctcat
gacagtggctccattgagctcgacttccatcagtggctaacatttacgatgatctag

DBGET integrated database retrieval system