KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223442
Entry
112223442         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04115  p53 signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04218  Cellular senescence
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112223442
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112223442
   04070 Phosphatidylinositol signaling system
    112223442
   04150 mTOR signaling pathway
    112223442
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112223442
  09143 Cell growth and death
   04115 p53 signaling pathway
    112223442
   04218 Cellular senescence
    112223442
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112223442
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112223442
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112223442
    3.1.3.48  protein-tyrosine-phosphatase
     112223442
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     112223442
Protein phosphatases and associated proteins [BR:otw01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    112223442
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3
Other DBs
NCBI-GeneID: 112223442
NCBI-ProteinID: XP_024242224
LinkDB
Position
24
AA seq 413 aa
MAAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDASKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKNQLDYKPVALLFHKMVFETVPMFSGGTCHPQFVVYQLKVKIHTSNPVNTRKEEKYVF
FEFPQPLPVCGDIKVEFFHKQNKMMKKVMXXXHFWVNTFFVPGPEENFEKVENGTLPTET
LPTATLPKEQAGNQTAGTGDNDKDYLILSLTKNDLDKANKDKANRYFSPNFKVKLYFTKT
VEDIFNSEASTSTSLTPDVSDNEADHYRYSDTTDSDPENEPFDEDQHTQITKV
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggctgcaatcataaaggaaattgtcagccgaaacaaaaggagataccaggaggatggg
tttgacttggacttgacttatatttatccgaacataattgctatgggctttcctgctgaa
agacttgagggtgtctacagaaacaacattgatgatgtagtacggtttctggactctaag
cacaaaaatcattacaagatctataatctgtgcgctgagcgacattatgacgcatccaaa
ttcaattgcagagttgcacaatatccgtttgaggatcacaatcccccccagctggagctg
attaaaccgttctgcgaagatcttgaccagtggttaagtgaggatgacaatcacgtggcg
gcgattcactgtaaagctggaaagggacgtacgggtgtcatgatctgtgcttacctgtta
caccggggcaagttcctcaaagcacaagaagctctggacttctatggagaagtcaggacc
agggataagaagggagtgacaatccccagccagaggcgctatgtctattactatagccac
cttctcaagaaccagctggattacaaaccagtggctctgctcttccacaagatggtgttc
gagacggtgcccatgttcagtggaggaacgtgtcatcctcagtttgtggtgtaccagctc
aaggtaaagatccacacgtccaacccggtgaacacgcggaaggaggagaagtatgtgttc
ttcgagttcccccagccgctgcccgtgtgcggagacatcaaggtggagttcttccacaaa
cagaataaaatgatgaagaaggtaatggannnnnttcacttttgggtgaataccttcttt
gtccctggaccagaggagaactttgagaaggttgagaacgggacgttaccaacggagacg
ttaccaacggcgacgttaccaaaggagcaggcaggaaaccaaactgcaggaacgggggac
aacgacaaggattacctgatcctctcactgacaaagaacgacctggacaaggccaacaag
gataaagcaaaccgatacttctcccccaacttcaaggtgaagctgtactttaccaagacc
gtggaggacatcttcaactctgaggccagcacttccacctcgctaacgccagacgttagt
gacaacgaggcggaccattaccgatactctgacaccacagactctgacccggagaacgaa
ccgtttgacgaagatcaacacacgcaaataacgaaagtgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224277
Entry
112224277         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04115  p53 signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04218  Cellular senescence
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112224277
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112224277
   04070 Phosphatidylinositol signaling system
    112224277
   04150 mTOR signaling pathway
    112224277
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112224277
  09143 Cell growth and death
   04115 p53 signaling pathway
    112224277
   04218 Cellular senescence
    112224277
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112224277
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112224277
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112224277
    3.1.3.48  protein-tyrosine-phosphatase
     112224277
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     112224277
Protein phosphatases and associated proteins [BR:otw01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    112224277
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase APG12
Other DBs
NCBI-GeneID: 112224277
NCBI-ProteinID: XP_024243514
LinkDB
Position
25
AA seq 426 aa
MAAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDATKFNCRVAQYPFEDHNPPQLELIKPFCEDLDLWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKNQLEYKPVALLFHKMVFETVPMFSGGTCRDTSVKNKSEQIPHGFRKGNWHWDPQFVV
YQLKVKIHTSNPVNTRREEKYVFFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPDEKVENGTLPKEQEGIQTTGGTGDNDKECLILSLTKNDLDKANKDKANRYFSPN
FKVSQVKLYFTKTVEDPFNSEASTSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEEQL
TQITKV
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggctgcaatcataaaggaaattgtcagccgaaacaaaaggagataccaggaagatggg
tttgacttggacttgacttatatttatccaaacataattgctatgggctttcctgctgaa
agacttgagggtgtctacagaaacaacatcgatgacgtagtacggtttctggactctaaa
cacaaaaatcattacaagatatataatctgtgcgctgagcgacattatgacgcaaccaaa
ttcaattgcagagttgcacaatatccgtttgaggatcacaatccgccccagctggagctg
atcaaaccgttctgcgaagatcttgacctttggttaagtgaagacgacaatcatgtggcg
gcgattcactgtaaagctggaaagggacgtacgggtgtcatgatctgtgcttacctgtta
caccggggcaagttcctcaaagcacaagaagctctcgacttctacggcgaagtcaggacc
agagataagaagggagtaacgatccccagtcagaggcggtatgtctactactacagccac
cttctgaagaaccagctggagtacaaaccagtggctctgctgttccacaagatggtgttc
gagacggtgcccatgttcagtggcggaacgtgtagggacacttccgttaaaaacaagagt
gagcagattccacatggtttcagaaaagggaattggcactgggatcctcagtttgtggtg
taccagctgaaggtaaagatccacacgtccaacccggtgaacacacggcgggaggagaag
tacgtgttctttgagttcccccagccgctgcctgtgtgtggagacatcaaggtggagttc
ttccacaaacagaacaaaatgatgaagaaggacaagatgtttcacttctgggtgaacacc
ttcttcatccctggaccagacgagaaggtggagaacgggacgttaccgaaggagcaggaa
ggaatccaaaccacaggaggaacgggagacaacgacaaggaatgcctgatcctctcactg
acgaagaacgacctggacaaggccaacaaggataaagcaaacagatacttctcccccaac
ttcaaggtcagtcaggtgaagctgtactttaccaagactgtggaggaccccttcaactcc
gaggccagcacttccacctcggtaacgccagacgttagtgacaacgagcctgaccattac
cgatactctgacaccacagactctgacccagagaatgaaccgttcgacgaggagcaactc
acacaaataacaaaagtgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112253032
Entry
112253032         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04115  p53 signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04218  Cellular senescence
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112253032
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112253032
   04070 Phosphatidylinositol signaling system
    112253032
   04150 mTOR signaling pathway
    112253032
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112253032
  09143 Cell growth and death
   04115 p53 signaling pathway
    112253032
   04218 Cellular senescence
    112253032
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112253032
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112253032
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112253032
    3.1.3.48  protein-tyrosine-phosphatase
     112253032
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     112253032
Protein phosphatases and associated proteins [BR:otw01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    112253032
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 112253032
NCBI-ProteinID: XP_024280662
LinkDB
Position
6
AA seq 440 aa
MAAKIKLMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDEVVRFLDSK
HKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFQDAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKNKLDYKPVALLFHKMVFETLPMFSGGTCRDSTVKNRSEPIPLGFKKGNWHWDPQFVV
YQLKVKIHTSNPAHTRREEKHMLFEFPQPLPVCGDVKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPPEESMEKVENGSVVVNDVDGVQNQSTIGTPPQAPQSAERRDSDRDYLILALTKN
DLDKANKDKANRYFSPNFKVKLYFTKTVEDSSNSEASTSTSVTPDVSDNEPDHYRYSDTT
DSDPENEPFDEEQHTQITKV
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggctgcgaagataaaattaatggtcagccggaacaaaaggagataccaagaggatggg
ttcgacttggatttaacgtatatctatccaaacatcattgctatgggctttcctgcagag
cgactcgaaggagtgtacagaaacaatatagacgaggttgtacggtttcttgactcgaaa
cataaaaaccattataagatttacaatctttgtgcagaacgacactacgatgctgccaaa
tttaactgcagagttgcacaatacccctttgaagaccacaacccgcctcagctagagctc
atcaagccgttctgtgaagacctcgaccagtggctgagcgaggatgacaatcatgtggcg
gccatccactgcaaggcagggaaaggccgcaccggggtgatgatctgcgcctacctcctg
caccgtggcaagttccaggacgcccaggaggcactcgacttctacggggaagtgcggaca
agggacaagaagggagtgacgatcccaagccaacggcgctacgtgtactactatagccac
ctgctgaaaaacaagctggactacaagcctgtggctctcctcttccacaaaatggtgttt
gagacgctaccaatgttcagtggaggcacctgcagggacagtaccgttaaaaacaggagc
gagccgatccctctgggcttcaagaaagggaattggcattgggatcctcagtttgtggtg
tatcaacttaaagtcaagatccacacatccaacccggctcacacgcggagggaagaaaag
cacatgttatttgagtttccccagccgctgcccgtctgtggagacgtcaaagtggagttc
tttcacaagcaaaacaaaatgatgaagaaggataagatgttccacttctgggttaacacc
ttcttcatccccgggccaccggaggagagcatggagaaggtggagaacgggtcagtggtg
gtgaacgatgtggacggggttcagaaccagtccacgattggcacccctccccaggccccg
cagagtgccgaacgcagggacagcgacagggactacctcatcctcgcgctcaccaagaat
gacctggacaaggccaacaaagacaaagctaaccgctacttctcacctaatttcaaggtg
aagttgtatttcacgaaaaccgtggaagattcttcgaattccgaggcgagcacttcgaca
tctgtcactccggacgttagtgacaacgagccagaccattatcgatattctgacaccact
gactctgatccggaaaacgaaccttttgatgaggagcagcacacgcagatcacgaaagtg
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254533
Entry
112254533         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04115  p53 signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04218  Cellular senescence
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112254533
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112254533
   04070 Phosphatidylinositol signaling system
    112254533
   04150 mTOR signaling pathway
    112254533
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112254533
  09143 Cell growth and death
   04115 p53 signaling pathway
    112254533
   04218 Cellular senescence
    112254533
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112254533
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112254533
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112254533
    3.1.3.48  protein-tyrosine-phosphatase
     112254533
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     112254533
Protein phosphatases and associated proteins [BR:otw01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    112254533
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 CDKN3
Other DBs
NCBI-GeneID: 112254533
NCBI-ProteinID: XP_024282977
LinkDB
Position
1
AA seq 446 aa
MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKSHYKIYNLCVERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRSKFQEPQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKNKLDYKPVALLFHKMVFETLPMFSGGTCRDSTIKNRSEPIPLGFKKGNWHWDPQFVV
YQLKVKIHTSNPAHTRREEKHMLFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPSEESIEKVENGSVVVVVNDMEGVQNQPPGGPHAQPPQSTKRRDSGKDSDGDYLI
LALTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEDSLNSEVSTSTSVTPDVSDNEPDHY
RYSDTTDSDPENEPFDEEQHTQITKV
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggctgcgataataaaagaaatggtcagccggaacaaaaggagataccaggaggatggg
ttcgacttggacttaacgtatatctatccaaacatcattgctatgggctttcctgcagaa
cgactcgaaggagtgtacagaaacaatatagacgacgttgtgcggtttcttgactcaaaa
cataaaagccattataagatttacaatctttgtgtagaacgacactatgatgctgccaaa
tttaactgcagagttgcacagtacccctttgaagaccacaatccgcctcagctagagctc
atcaagccattctgtgaagatctggaccagtggctgagcgaggatgacaatcatgtggcg
gccatccactgcaaggcagggaagggccgcactggggtgatgatctgcgcctacctcctg
caccgcagcaagttccaagagccccaggaggccctcgacttctatggggaagtgcggaca
agggacaagaagggagtgacaatcccgagccaacggcgctatgtgtactactacagccac
ctgctgaagaacaagctggactacaagccagtggctctgctcttccataaaatggttttt
gagacgctgccaatgttcagcggaggcacctgcagggacagtaccattaaaaacaggagc
gagccgatccctctgggcttcaagaaagggaattggcattgggatcctcagtttgtggtg
tatcaacttaaagtcaagatccacacatccaacccggctcacacacggagggaagaaaag
cacatgctatttgagtttccccaaccgctgcccgtgtgtggagacatcaaagtggagttc
tttcacaagcaaaacaaaatgatgaagaaggataagatgttccacttctgggttaacacc
ttcttcattcccgggccatcggaggagagcatagagaaggtggagaacgggtcggtggtg
gtggtggtgaacgacatggaaggggtccagaaccagcccccgggcggcccccatgcccag
cccccccagagcaccaagcgcagggacagcggcaaagacagtgacggggactacctcatc
ctcgcgctgaccaagaatgacctggacaaggccaacaaagacaaagctaaccgctacttc
tcacctaatttcaaggtgaagttgtatttcacaaaaaccgtggaagattctttgaattcc
gaggtgagcacttcgacatccgtcactccggacgttagcgacaatgagcctgaccattat
cgatattccgacaccactgactctgatccggaaaatgaaccttttgacgaggaacagcac
acgcaaatcacaaaagtgtga

DBGET integrated database retrieval system