KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223541
Entry
112223541         CDS       T05605                                 

Definition
(RefSeq) glucose-6-phosphatase-like
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00010  Glycolysis / Gluconeogenesis
otw00052  Galactose metabolism
otw00500  Starch and sucrose metabolism
otw01100  Metabolic pathways
otw04068  FoxO signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112223541
   00052 Galactose metabolism
    112223541
   00500 Starch and sucrose metabolism
    112223541
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112223541
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112223541
   04920 Adipocytokine signaling pathway
    112223541
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     112223541
SSDB
Motif
Pfam: PAP2 DUF4181
Other DBs
NCBI-GeneID: 112223541
NCBI-ProteinID: XP_024242378
LinkDB
Position
24
AA seq 357 aa
MEAVTDAFQSYGVSTTNYLQTNYKDAQGLFLWVSWAADLRNTFFIFFPLWFHLRESVGIK
LIWVAVIGDWLNLVFKWILFGERPYWWVHETPYYSNTTAPHIEQYPMTCETGPGSPSGHA
MGAASIYYTLVTSILAIMLTKKKTRASTKGMYLRGTLWAFFWAVQVCVCLSRVFIAAHFP
HQVICGVITGIVVAEAFNRTQWIYGASLKKYFYTTVFLLSFAVGFYVLLKALGVDLLWTL
EKAQKWCVRAEWVHMDSTPFASLLRNMGTLFGLGLGVHSPLYTESKKNSSTPFRVGCIVT
SLLLLHLFDSFKPPTHTAALFYLLSFCKSATVPLATVSIIPYCMSGALSSVQSKKHL
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggaggcagtcacggatgcctttcagagctatggggtgagcaccactaattacctccag
accaactataaggatgcacagggtttgttcctgtgggtgtcctgggctgctgacctcagg
aacaccttcttcatcttcttccccctctggttccacctgcgggagtcggtgggtatcaaa
ctcatctgggtggcagtgatcggcgactggctcaacctggtcttcaagtggattctgttt
ggcgagaggccgtattggtgggttcatgaaacaccttactacagcaataccactgcacct
cacattgaacaataccccatgacctgtgagactggcccaggcagtccctctggccacgct
atgggagccgcaagcatctactacacactggtcacctccatcctagccatcatgctgacc
aagaagaagacgagagcttccaccaagggcatgtatctgcggggcactttgtgggcattc
ttctgggccgtccaggtgtgtgtctgtctctccagagtcttcattgctgcccacttcccc
caccaagtcatctgtggagtcatcacaggtattgttgtggccgaggccttcaacagaacc
cagtggatctacggagccagtctgaagaagtacttctacaccaccgttttcctgctctcc
ttcgctgttggcttctacgtgctgctgaaggctctgggcgtggacctgctgtggaccctg
gagaaagcccagaagtggtgtgtaagggctgaatgggtccacatggactccactcccttc
gccagcctcctgcgcaacatgggcaccctgtttggcctgggcctgggcgtgcactcgccc
ctctacaccgagagcaagaagaacagcagcacccccttcagggtgggatgtatcgttacc
tcgctgctcctgctgcacctctttgactccttcaagccccccacgcacaccgccgccctc
ttctaccttctgtctttctgtaagagcgccactgtccccttggcaaccgtgagcatcatc
ccctactgcatgtcaggagcattgagcagtgtacagagcaagaagcatctgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224175
Entry
112224175         CDS       T05605                                 

Definition
(RefSeq) glucose-6-phosphatase-like
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00010  Glycolysis / Gluconeogenesis
otw00052  Galactose metabolism
otw00500  Starch and sucrose metabolism
otw01100  Metabolic pathways
otw04068  FoxO signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112224175
   00052 Galactose metabolism
    112224175
   00500 Starch and sucrose metabolism
    112224175
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112224175
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112224175
   04920 Adipocytokine signaling pathway
    112224175
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     112224175
SSDB
Motif
Pfam: PAP2 DUF4181
Other DBs
NCBI-GeneID: 112224175
NCBI-ProteinID: XP_024243307
LinkDB
Position
25
AA seq 352 aa
MDLFHSWGVEVAIHLQTQYGHYEGWFSLASTVADLHTTFFCFFPVWFHLRRDVGVKLIWV
AVIGDWLNLVMKWVLFGERPYWWVHDTRFYGTDPAPALKQFPITCETGPGSPSGHAMGSS
GVWYVMITAVFSVATERWFPPLLYRFLQVGLWMLLCTVELLVCMSRVYMAAHFPHQVISG
VITGIMVAEAFSRVQWIYGASLKKYFYTTLFLLTFAVGFYELLKAIGVDLLWSLEKAQKW
CVRAEWVYMDSTPFASLLRNMGTLFGLGLGLHSPLYTENKNSSIPFRVGCITVSLLLLQI
LDGLTFSSKDQAVFYVLSFSKSAAALFIPTALVPGGLSWIFPGSGAAKLKFS
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggatcttttccacagctggggggtggaagtggccatccatctgcagacccagtatggg
cattatgagggctggtttagcctagcctctacagtggctgacctgcataccaccttcttt
tgtttcttcccagtctggttccatctgcgcagggacgtgggtgtaaagctcatctgggtg
gctgtcattggggactggctcaacctggtcatgaagtgggttctatttggagagagaccc
tattggtgggtccatgatacccgcttctatgggacagatccagcccctgccttaaaacaa
ttccccatcacctgtgaaactggaccaggaagcccttcgggtcatgccatgggctcgtct
ggggtgtggtacgtgatgataacagctgtcttctcagtggcaacagaaagatggttccca
cctctcctgtacaggttcttgcaggtggggctctggatgctgctgtgtacagtagagctg
ctggtgtgcatgtccagagtctacatggctgcccacttcccgcaccaggtcatcagtggg
gtcatcacaggtatcatggtggctgaggccttctccagagtgcagtggatctatggagcc
agtctgaagaagtacttctacaccaccctctttctgctcacctttgctgtgggcttctac
gagctactgaaagctataggcgtggacctgctgtggtccctggagaaagcccagaagtgg
tgtgtgagagccgagtgggtctacatggactccactcctttcgccagcctcctgcgcaat
atgggcaccctgtttggcctgggcctgggcctgcactcacccctctacaccgagaacaag
aacagcagcatccccttcagggtggggtgtatcactgtctctttattgttgctacagatt
ttggatggcttgacgttctcctcgaaagaccaggcagtgttctatgtgttgtcatttagt
aagagtgctgctgctctcttcattcccacagctctggttcccggaggactctcctggatc
ttcccaggtagtggggcggctaagctgaaattttcataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224176
Entry
112224176         CDS       T05605                                 

Definition
(RefSeq) glucose-6-phosphatase-like
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00010  Glycolysis / Gluconeogenesis
otw00052  Galactose metabolism
otw00500  Starch and sucrose metabolism
otw01100  Metabolic pathways
otw04068  FoxO signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112224176
   00052 Galactose metabolism
    112224176
   00500 Starch and sucrose metabolism
    112224176
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112224176
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112224176
   04920 Adipocytokine signaling pathway
    112224176
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     112224176
SSDB
Motif
Pfam: PAP2 FTR1 DUF4181
Other DBs
NCBI-GeneID: 112224176
NCBI-ProteinID: XP_024243308
LinkDB
Position
25
AA seq 358 aa
MEAVMDAMQGYGVSTTNYLQTNYKDAQGLFLWVSWAADLRNTFFIFFPLWFHLRESVGIK
LIWVAVIGDWLNLVFKWILFGERPYWWVHETPYYSNTTAPHIEQYPMTCETGPGSPSGHA
MGAAGVYYTLVTSILAIMLTKNKMGSSSKGLYLRGTLWAFFWAVQVCVCLSRVFIAAHFP
HQVICGVITGMVVAEAFNRTQWIYGASLKKYFYTTLFLLSIAVGFYVLLKALGVDLLWTL
EKAQKWCVRAEWVHMDSTPFASLLRNMGTLFGLGLGLHSPLYTESKNISGTTLFRTGCIV
TSLLLLHLFDSFKPPTHTAAVFYLLSFCKSATVPLATVSIIPYCVSGALSSVQSKKYL
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggaggcagtcatggatgccatgcagggctatggggtgagcaccactaattaccttcag
accaactataaggacgcccagggtttgttcctgtgggtgtcctgggctgctgacctcagg
aacaccttcttcatcttcttccccctctggttccacctgcgggagtcagtgggcatcaag
ctcatctgggtggcagtgatcggcgactggctcaacctggtcttcaagtggattctgttt
ggcgagaggccgtattggtgggtccatgaaacaccttactacagcaataccactgcacct
cacattgaacagtatccaatgacctgtgaaactggcccaggcagtccttctggccacgct
atgggagctgcaggcgtctactacacactggttacctccattctagccatcatgctgacc
aagaataagatgggatcttcctccaagggcctgtatctacggggcactctgtgggcgttc
ttctgggcggtccaggtctgtgtgtgtctctccagagtcttcattgctgcccacttcccc
caccaagtcatctgtggagtaatcacaggtatggttgtggccgaggcgttcaacagaacc
cagtggatctacggagccagtctgaagaagtacttctacaccaccctctttctgctctcc
atcgctgtgggcttctacgtgctgctgaaggctctaggcgtggacctgctatggaccctg
gagaaagcccagaagtggtgtgtgagagccgagtgggtccacatggactccactcccttc
gccagcctcctgcgtaacatgggcacactgtttggcctgggcctgggcctgcactcgccc
ctctacaccgagagcaagaacatcagcggcaccaccctctttaggacgggatgtatcgtc
acctcgctgctcctgctgcacctctttgactccttcaagccccccacgcatactgccgct
gtcttctacctgctgtctttctgtaagagcgccactgtccccctggcaaccgtcagcatc
atcccctactgcgtgtctggagctctgagcagcgtacagagcaagaagtatttgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224512
Entry
112224512         CDS       T05605                                 

Gene name
g6pc3
Definition
(RefSeq) glucose-6-phosphatase 3
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00010  Glycolysis / Gluconeogenesis
otw00052  Galactose metabolism
otw00500  Starch and sucrose metabolism
otw01100  Metabolic pathways
otw04068  FoxO signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112224512 (g6pc3)
   00052 Galactose metabolism
    112224512 (g6pc3)
   00500 Starch and sucrose metabolism
    112224512 (g6pc3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112224512 (g6pc3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112224512 (g6pc3)
   04920 Adipocytokine signaling pathway
    112224512 (g6pc3)
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     112224512 (g6pc3)
SSDB
Motif
Pfam: PAP2 Phage_holin_8
Other DBs
NCBI-GeneID: 112224512
NCBI-ProteinID: XP_024243876
LinkDB
Position
25
AA seq 339 aa
MEAIHTQGIWIAEALQQRTKSQDKLWLIATHIGDPKAAFLLVFPLTYFLNRRTGFAVVWV
AAISEWLNLVFKWMLFGERPFWWIGESRLFEKNPPKLQQFASTCETGPGSPSGHAMVTAA
VWWVMASSLGSLLYSYTRSMLLSAVPYVLYLLGLVAVGFSRIFILAHFPHQVIAGSLTGF
ILGVVLSRQVPEGRPLVFFVSSSIGLLLSAFLIHSGLTWLGFDLSWSIALAKKWCSHSEW
IRLDTAPFSSLTRDCGAILGLGLAQYWKPGGYTLPCAPRALCLALCSMALYHVHRLPLPI
QPQPLFYFLFFIKFTIVPQVVMIYVPGFVHLLTHKKKND
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggaggccatacacacccaaggtatttggattgctgaagcacttcagcaaagaacgaag
agccaagacaaactttggttgattgccactcacattggggatcccaaagctgccttcctt
ctcgtgttccccttgacttactttctcaaccgacggactggatttgcagttgtctgggtg
gctgctatttcggagtggcttaatctagtgttcaaatggatgctctttggggagagacca
ttctggtggattggagaatcccgtttatttgagaaaaaccctcccaaactccaacagttt
gcctcaacttgtgaaacaggtccaggcagtccatctggtcatgcaatggtaacagcagca
gtgtggtgggtgatggcctcatccctgggttctcttctctactcctacacacgcagcatg
ttgctatcagcggttccatatgtgctgtatctgctggggttagtggcagttggcttctct
cgcatcttcatcctggcacacttcccccatcaggtcatagctggctctttgacaggcttc
attcttggggtagttctgagccgtcaggttccagaaggtcgccctctggtgttttttgtg
agttccagcattgggctactcctcagtgctttcctaatccactcaggactgacatggctg
ggcttcgacttgtcctggtccattgcgttggctaagaagtggtgctcccattcagagtgg
attcggctggacacagccccgttttcctcactaacacgggactgtggtgctatcctgggc
ttggggctggcccagtactggaagccaggtgggtacactctcccctgtgctccacgtgcc
ctgtgtctggccctctgctccatggctctctaccatgtccatcgactgcctctaccaatc
caaccacagcccctcttctacttcctcttctttatcaagtttaccatcgtgccccaggtg
gtcatgatttatgtacctggctttgtacacctccttacacacaaaaagaaaaatgattaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112236295
Entry
112236295         CDS       T05605                                 

Gene name
g6pc2
Definition
(RefSeq) glucose-6-phosphatase 2
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00010  Glycolysis / Gluconeogenesis
otw00052  Galactose metabolism
otw00500  Starch and sucrose metabolism
otw01100  Metabolic pathways
otw04068  FoxO signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112236295 (g6pc2)
   00052 Galactose metabolism
    112236295 (g6pc2)
   00500 Starch and sucrose metabolism
    112236295 (g6pc2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112236295 (g6pc2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112236295 (g6pc2)
   04920 Adipocytokine signaling pathway
    112236295 (g6pc2)
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     112236295 (g6pc2)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 112236295
NCBI-ProteinID: XP_024260642
LinkDB
Position
3
AA seq 407 aa
MLSSKIEPQPRLMKRKVTPIHKERLMSMVQHCSCGQGSSCPSRARQTEPQMDLIHSSGVL
VIQHLQSNYKDYHDFLDFMSSVGDPRNIFSLYFPLWFQLSQIVGTKMIWVAVIGDWFNLI
FKWILFGQRPYWWVHETLFYQNNSLPQLEQFHITCETGPGSPSGHAMGSSCVWYVMITSA
LNFSRRLCDSSTQGCQRFGLVWSFLWMAFWIIQISVGISRIFIATHFPHQVILGVLAGIL
VAEAFEHVPSIHTASLKVYLHTSLFLFSFAVSLYLLLKMIDIDLLWSIPKAKKWCANPDW
IHLDTTPFAGLVRNLGALFGLGLAINSQMFIQSCKVKNGYKTRFKLVCVAANLTSLQLYD
FIKIPTHTEILFYTLSFCKSAAVPLSVVALIPYGVHLLIGDKERKLD
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgctttcatccaagatagagccacagccaagactgatgaagaggaaagtaacacccata
cacaaggagagactgatgtccatggtgcagcattgtagttgtggccaagggagcagctgt
cccagtcgtgccagacagactgaaccccagatggacctcatccacagcagtggggtgctg
gtgatccagcacctccagagcaactacaaggactaccatgacttccttgacttcatgtcc
tctgtgggcgacccgcgtaacatcttttctctctatttccctctgtggtttcagcttagc
caaattgtcggcaccaagatgatatgggtggcagttatcggagactggttcaacctaatt
ttcaaatggattctgtttggtcaacggccatactggtgggtgcatgaaactctcttttac
cagaataattcactcccccagctggagcagttccacattacctgtgaaacaggaccaggc
agtccatccggtcatgccatgggctcttcgtgtgtctggtatgtaatgatcacatcagca
ctcaactttagcagacgcctttgtgacagctcaactcagggttgccagaggtttgggctt
gtgtggtcctttttgtggatggcattttggatcattcagattagtgttggcatctccagg
atcttcatcgccacacacttccctcaccaggttatccttggtgttctagctggtatacta
gttgctgaagcatttgagcatgttccctcgatccacacagccagtttaaaagtctacctt
cacactagcttatttctgttctcctttgccgtcagcctttacttgctccttaaaatgata
gacattgacctattgtggtcgatacctaaagcaaagaagtggtgtgccaatccagactgg
atccacctggacactacaccttttgctggtttagtgaggaacctgggagcattgtttgga
cttggcctggccattaactctcagatgttcatccagagctgcaaggtgaagaacggctac
aagactaggtttaaactcgtgtgtgtagcagccaatctgacctctctgcagctgtacgat
ttcatcaaaattcccactcacacagagatcctgttctacacactctcattctgtaagagt
gctgcagtccctcttagtgtggtggcactcatcccctacggtgttcacttgttgatagga
gacaaggagaggaaattagactaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258789
Entry
112258789         CDS       T05605                                 

Definition
(RefSeq) glucose-6-phosphatase-like isoform X1
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00010  Glycolysis / Gluconeogenesis
otw00052  Galactose metabolism
otw00500  Starch and sucrose metabolism
otw01100  Metabolic pathways
otw04068  FoxO signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112258789
   00052 Galactose metabolism
    112258789
   00500 Starch and sucrose metabolism
    112258789
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112258789
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112258789
   04920 Adipocytokine signaling pathway
    112258789
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     112258789
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 112258789
NCBI-ProteinID: XP_024289140
LinkDB
Position
9
AA seq 360 aa
MDTVHAYGVSXTRYLQTHYRDTQSWFLFVSMXADLRNTXFVFFPVCFHLRESVGVKLVWV
AVVGDWLNLIFKWILFGERPYWWVQETPYYANSSAPQIXQFPMTCETSPGSPSGHAMSAA
GVYYAMISSLLAILLKEHGGHIKNWCVHGTLWAVFWCVQVCVCLSRVFIAAHFPHQVVAG
VVTGILVAETFDRVXWIYRASLRRYVYTXLSLLSFAVGLYLVLRGLGVDLLWTLDKAQRW
CQRPQWVHIDTTPFASLLRNTGTLLGLGLGLHSPQYAEARRVGGGATYRLACVGATLLLL
HLLDSFRPPAHSRALFYLLSFCKSATVPLATVGIVPYCVAGAAGRNGKKHQGSVLPAVLL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggacaccgtccacgcctatggygttagcyccacacgatacctccagactcactacagg
gacactcagagctggttcctytttgtttccatggragctgacctgcggaacaccrtcttt
gtrttcttccctgtgtgtttccacctgcgggaatcagtgggggtcaagctggtctgggtg
gctgtggtgggagactggctcaaccttatcttcaaatggatcctgtttggcgagcgtccc
tattggtgggtacaagagactccttactatgccaactcatcagcgccacaaattgygcag
ttccctatgacctgtgagactagtccaggaagtccgtcgggtcatgccatgagtgctgca
ggggtttactacgctatgatctcatcactcctcgccatcctcctcaaggaacacgggggt
cacatcaagaactggtgtgtccacgggaccctgtgggctgtcttctggtgtgtgcaggtg
tgtgtctgcctctccagggttttcattgctgcccacttccctcaccaggttgtcgctggg
gtcgtcacaggcatcctagtggcggagacctttgaccgggtccastggatctacagggct
agcctgaggcgctacgtctacaccascctctccctgctctccttcgctgtgggcctttac
ctggtcctcaggggcctgggggtggacctgctctggaccctggacaaggcccagcgctgg
tgccagcggccccaatgggtccacatagacactacacccttcgccagcctcctgcgcaac
accggcactctgttaggcctgggcttgggcttgcactcgccccaatacgccgaggcccgg
agagttggcggtggcgccacctacaggctggcatgtgtgggcgccacactgctgctgctc
cacctactggactcattcaggccaccagcccactccagggctctgttctacctgctgtcc
ttctgtaagagtgccactgtgcccctggccactgtgggcatagtgccctactgcgtggcc
ggggcagcgggacggaacggaaagaaacaccagggctctgttctacctgctgtccttctg
taa

DBGET integrated database retrieval system