KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223622
Entry
112223622         CDS       T05605                                 

Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha-like isoform X1
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04623  Cytosolic DNA-sensing pathway
otw04625  C-type lectin receptor signaling pathway
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112223622
   04068 FoxO signaling pathway
    112223622
   04150 mTOR signaling pathway
    112223622
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112223622
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112223622
   04621 NOD-like receptor signaling pathway
    112223622
   04622 RIG-I-like receptor signaling pathway
    112223622
   04623 Cytosolic DNA-sensing pathway
    112223622
   04625 C-type lectin receptor signaling pathway
    112223622
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112223622
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112223622
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112223622
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112223622
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     112223622
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   112223622
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD APH
Other DBs
NCBI-GeneID: 112223622
NCBI-ProteinID: XP_024242480
LinkDB
Position
24
AA seq 767 aa
MDKPPFRQNQNCGDWEFKERLGMGSFAHVYLYQNHDTLEKIAVKMCRLELIPRNKDRWSR
EIQIMKKLNNLNVVTARDVPEEMKHIALNDLPLLAMEYCSKGDLRKMLSKPENCCGLKES
EVLSLLNDVGSGVQYLHENKIIHRDLKPENVVLQDVNGKLVHKIIDLGYAKDLDQGSLCT
SFVGTLQYLAPELFENKPYTVTVDYWSFGTMIFECSCGFRPFLHNLQPVQWASKVRSKGP
KDIMAVEELNGDVRFSTHLPYPNNLSRTLLERMEMLLQLMLKWDPVQRGGKTNADSKKPQ
CFEVLEQILCMKVVHILNMTTAQVHSFQLVPEESLHSLQRRIETETNIELVNQELLQETG
VSLDPRKAAAQCVLDGVRGWDSYIIYLFDKSLTKYSGPFSARQLPDEVNAIVREAKSQLP
LVVLKKVWGEAVSYICGLKDDYSRLFQGQRAAMLSLLRYNTNLTRCKNGMFAFSQQLKAK
LDFFKSSIQYDLEKYSDQMHYGISSEKMLKAWQENEGKAAAYAQVAEVSHLDEEIMSLHS
EIVELQRSPYARRQGDVMEQLEEKAIELYKQLKMKCRTPDPDVSSDSSEMVKAIIQTVQN
QDKVLRDLYAHLSKILLSKQKIIDLFPRIEKTLENIKDADNTVMQMQVKRQREFWHLLKI
ACVSDREAQNSARNSIAASPELSNPLQVSQWAQSAQPISNPHPLTSLPGPNDSDAAPRLL
QENQKYLSQLTSLMQEAADEQSKSIVEQDWSWTKYETLSTKLLKRNV
NT seq 2304 nt   +upstreamnt  +downstreamnt
atggataagcctcctttcagacaaaaccaaaactgtggagactgggaattcaaagagaga
ttgggcatgggcagttttgcccatgtctacctgtatcaaaatcatgatacattggaaaaa
atagcagtgaaaatgtgtcgtctggagttaataccacgaaacaaagacaggtggagcaga
gagatccagatcatgaaaaagttgaataatctcaatgtagtgacagcgcgagacgtgcca
gaggagatgaagcacattgccttaaacgaccttccactgctggccatggagtactgctcc
aagggagacctcagaaagatgctgagcaagccagaaaattgctgtggcctgaaagaaagt
gaagtgctttccctgcttaatgacgttggttcaggcgtccagtatttacatgaaaacaag
atcatacacagagaccttaaaccagaaaatgtagtgctgcaggatgtcaacggaaagttg
gttcacaaaatcatagacttgggctatgccaaagacttggaccaggggagtctgtgcacc
tcttttgtgggaacactgcagtacttggcacctgagctatttgagaataaaccttacact
gtcacagtggactactggagttttggcacaatgatatttgaatgcagctgtggattccgt
ccgtttctgcacaatcttcagccggtccaatgggccagcaaagtgcggagcaaaggtccc
aaagacatcatggccgtggaggaattgaatggggacgtcagattctccacacatctacca
taccccaacaatctgagcaggacactgctggagcgcatggagatgctgcttcagctgatg
ctgaaatgggatcctgtccagaggggaggcaagaccaacgctgacagcaagaaaccccag
tgcttcgaagtgctggaacaaatattatgcatgaaggttgtccacatcctaaacatgacc
acagcccaggtccactccttccaactggtcccagaggagagcctccatagcctgcagcgc
cgcatcgagactgagaccaatattgagctggtcaaccaggagcttttgcaggagacgggg
gtgtcgctggaccccaggaaggctgcagcccagtgtgtccttgatggggtgcgaggctgg
gacagttacatcatctatttgtttgacaagagcctcaccaagtactctggtcccttcagt
gctagacagctgcctgatgaagtcaacgctattgtacgggaagctaagtcccagcttccc
ttggtggtgctgaagaaggtgtggggcgaggcggttagttacatctgtggactgaaggac
gactacagtagattgttccagggccagagggctgccatgctgagcctcctacgctacaac
accaacctgacccggtgcaagaacggcatgtttgccttctcccagcagctgaaggctaag
ctggacttcttcaagagcagcattcaatacgacctggagaagtacagcgaccagatgcat
tatgggatctcgtcagagaagatgctgaaagcgtggcaggagaatgaggggaaagctgct
gcttatgcacaggtggcagaggtgagccacctggacgaggaaatcatgtcgttacactca
gagattgtggagctgcagcggagtccctacgcccgtcgccaaggagacgtcatggagcag
ctagaggagaaggccattgaactctacaaacaactgaagatgaaatgcagaacgcctgac
cctgatgtgagcagcgacagctccgagatggttaaagccatcatccagactgtccagaac
caagacaaggtcctccgagacctctacgcacatctcagtaagatcttactgagcaagcag
aagataattgacctgttcccacggattgagaagacgctggagaacatcaaggatgccgac
aacactgtgatgcagatgcaggtcaagagacagagagagttctggcacctactgaagatt
gcctgtgtgagtgacagagaggctcagaactctgcaaggaactcgatagcagccagccca
gagttgtccaaccccctgcaggtgtcccagtgggcccagtctgcccagcccatcagcaac
cctcaccccctgacctccctaccaggacccaacgatagtgatgctgccccgcgtctgctt
caggagaaccagaagtacctcagtcagctgaccagcctgatgcaggaagctgctgatgag
cagtccaaaagcatagtggagcaagattggagctggactaaatacgaaacattgtctacg
aaactgctcaaacgaaatgtgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223895
Entry
112223895         CDS       T05605                                 

Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha-like isoform X1
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04623  Cytosolic DNA-sensing pathway
otw04625  C-type lectin receptor signaling pathway
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112223895
   04068 FoxO signaling pathway
    112223895
   04150 mTOR signaling pathway
    112223895
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112223895
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112223895
   04621 NOD-like receptor signaling pathway
    112223895
   04622 RIG-I-like receptor signaling pathway
    112223895
   04623 Cytosolic DNA-sensing pathway
    112223895
   04625 C-type lectin receptor signaling pathway
    112223895
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112223895
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112223895
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112223895
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112223895
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     112223895
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   112223895
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo Kinase-like YrbL-PhoP_reg TBK1_ULD APH
Other DBs
NCBI-GeneID: 112223895
NCBI-ProteinID: XP_024242981
LinkDB
Position
24
AA seq 754 aa
MEKVPVKQSQVCGLWELKEQLGTGGFGHVYLYQHLETSEKIAVKLCRLELNSKNRERWSR
EIQIMKKLSHDNVVRAREVPEEMSFIALNDLPLLAMEYCSRGDLRKLLNKPENCCGLKES
QVLSLLSHVGSGIQYLHENKIIHRDLKPENIVLQETSGKFVHKIIDLGYAKDLDQGSLCT
SFVGTLQYLAPELFENKPYTVSVDYWSFGTMIFECTCGFRPFLHNMQPVQWTNKVRNKGP
KDIMAVEDMNGEVRFSTHLPYPNNLSRSLLEPVESLLQMLLLWDPATRGGVTDRDTHTPC
CYTTLQNILNMKVMHVLDMTSAQLHSFVLGSEEGLHSLQQRVETHTHTHIPPLSQELLLE
TGVSLDPRRPPAHCLPDGPRGWDNAIVYLFDKSLTKYSGPFTARPLPDSVNFIVRETKTQ
LPLAALRKVWGEAVSYVCGLRGDYSRLYQGQRAAMLSLLRYNTNLTRYKNVLFSQSQQLR
AKLAFFTTSIQQDLQHYDQQRDTGISSEKMLKAWQDNEQKADAFTQVSEVGYLDEEIVCL
HSEIVELQRSPFARRQADIMEQLEEKAIELYKQLKAKCKSPDPPHGYSDSSEMVKTIVQT
VQNQDRILRDLYTHLSKILECKCRIVALFPKLEGAVESIKAAEAAVMTMQMKRQREFWHL
LKIACAQNGSHNSLTPSSDVSSPPPLTMNPLRHTHSESVCHLLDENQRYLSQLTSLLQET
SQDKTCSIMDQDWSWTQYGSVVDPTLETLDTHTH
NT seq 2265 nt   +upstreamnt  +downstreamnt
atggagaaagtcccggtcaaacagagccaagtgtgtgggctgtgggagctgaaggagcag
ttggggaccggagggtttggacacgtttacctgtaccagcacctggagacatcagagaag
atcgcagtgaaattgtgtcgtctggagctgaactcaaagaacagagaacgctggagtaga
gagatacagattatgaagaagttgagccatgataatgtggtgagagccagggaggttcca
gaggagatgagttttatagcgctcaatgacctgccactactggccatggagtattgctct
agaggagacctacgcaagctgctgaacaagccagagaactgctgtggactgaaggagagt
caagtcctttctctactcagccatgttgggtctggtatccagtacctccatgagaataag
atcatccacagggacctgaagcctgagaacatcgtactgcaggagaccagtgggaagttt
gtccataagatcatagatctgggttacgctaaagacttggaccagggcagtctctgtaca
tccttcgtcggaactctgcagtacctggctccagagctgtttgagaataagccctatact
gtgtcagtggactactggagttttgggaccatgatctttgagtgtacctgtggcttccgc
ccgttccttcacaacatgcagccggttcagtggaccaataaagtacgcaacaaaggtccc
aaggacatcatggctgtagaggatatgaatggagaagtgagattctctacacacctaccc
taccccaacaatctgagcaggtccctgttagagccagtggaatctctgctacagatgctg
ttgctgtgggaccctgcgacaagaggaggagtgacagaccgtgacacacacacaccctgt
tgctacactaccctacagaacatactcaacatgaaggtgatgcatgtgttggacatgaca
tcggcccagctccactccttcgtccttggcagtgaggaggggttacactccctgcagcag
cgtgtggagacacacacccacacacacatccctccgctcagccaggagctgctgttggag
actggagtctccctggaccctcgcagaccaccagcacattgcctccctgatggaccgcga
ggctgggacaacgccatagtctacctgtttgataagagtctgactaaatactctggacct
ttcactgcccgacccctgcctgacagcgtcaacttcatagtgagggagacgaagacccag
ctgcctcttgctgctctaaggaaggtgtggggagaggctgttagctatgtctgtggtctg
agaggggactacagcagactgtaccagggacagagagctgccatgttgagtctgctacgc
tacaacaccaacctgacgcggtataagaacgtgttgtttagccagtctcagcagctcaga
gccaaactggccttcttcaccaccagcatacaacaagacctacagcactacgaccagcag
agagacactggcatctcctctgaaaagatgctgaaagcctggcaggacaatgaacagaaa
gctgatgcttttacacaggtatcagaagtgggctatctggatgaggagatagtgtgtctc
cactctgagatcgtggagctgcagaggagtccgtttgccaggagacaagctgacatcatg
gaacaactggaggagaaggccattgaactttacaagcagctgaaggccaaatgcaagagt
ccagacccccctcatggctacagtgacagttcagaaatggtgaagaccattgtccagaca
gtccagaaccaggaccgaatcctcagagacctgtacacacacctcagtaagatcttggag
tgtaagtgtcgtattgtagcattgtttcctaagctggagggggcagtggaaagcatcaag
gcagcagaggctgcagtcatgactatgcagatgaagagacagagagagttctggcacctg
ctcaagattgcctgtgcccagaatggcagtcacaactctctaacccccagctcagacgtc
tctagtccccctcctctcaccatgaacccactaagacacacacacagtgagtcagtatgc
cacctactggatgagaaccagcgttacctgagtcagctgacctctctactgcaggagacc
tcacaggacaaaacatgcagtatcatggaccaggactggagttggactcagtatggatct
gtggttgacccaaccctagagactctagacacacacacgcactag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224128
Entry
112224128         CDS       T05605                                 

Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha-like
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04623  Cytosolic DNA-sensing pathway
otw04625  C-type lectin receptor signaling pathway
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112224128
   04068 FoxO signaling pathway
    112224128
   04150 mTOR signaling pathway
    112224128
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112224128
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112224128
   04621 NOD-like receptor signaling pathway
    112224128
   04622 RIG-I-like receptor signaling pathway
    112224128
   04623 Cytosolic DNA-sensing pathway
    112224128
   04625 C-type lectin receptor signaling pathway
    112224128
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112224128
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112224128
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112224128
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112224128
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     112224128
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   112224128
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD YrbL-PhoP_reg APH
Other DBs
NCBI-GeneID: 112224128
NCBI-ProteinID: XP_024243218
LinkDB
Position
25
AA seq 761 aa
MDKPPFRQNQNCGNWELKERLGMGGFAHVYLYQHHDTSEKIAVKMCRLELTARNKDRWSR
EIQIMKKLSNLNVVTARDVPEEMKHIALNDLPLLAMEYCSKGDLRKMLSKPENCCGLKES
EVLSLLNDVGSGIQYLHENKIIHRDLKPENIVLQEVNGKLVHKIIDLGYAKDLDQGSLCT
SFVGTLQYLAPELFENKPYTVTVDYWSFGTMIFECSCGFRPFLHNLQPVQWASKVRNKGP
KDIMAVEELNGEVRFSTHLPYPNNLSRTLLEPMEMLLQLMLKWDPVQRGGKTNADSKKPL
CFEVLEQILCMRVVHILNMTTAQVHSFQLAPDESLHSLQRRIETETKIELVNQELLQETG
VSLDPRKPAAQCVLEGVRGWDSYIIYLFDKSLTKYSGPFSARQLPDKVNTIVREAKSQLP
LVVLKKVWGEAVSYICGLKDDYSRLFQGQRAAMLSLLRYNTNLTRCKNGMFAFSQQLKAK
LDFFKSSIQYDLEKYSDQMHYGISSEKMLKAWQENEEKAAAYAQVAEVSHLDEEIMSLHS
EIVELQRSPYARRQGDIMEQLEDKAIELYKQLKMKCRTPDPGVSSDSSEMVKAIIQTVQN
QDKVLRDLYTHLSKILLSKQKIIDLFPRIEKTLENIKDADNTVMQMQIKRQREFWHLLKI
ACAQNSARNSIAASPESSNPLQVSQWAQSAQPISSPHPLTSLPGPNDSDAAPRLLQENQK
YLSQLTSLMQEAADEQSKSVVDQDWSWTKYETSTKLQKRNV
NT seq 2286 nt   +upstreamnt  +downstreamnt
atggataagcctcctttcagacaaaaccaaaactgcgggaactgggaattgaaagagaga
ttgggcatgggcggttttgcccatgtctacctgtatcaacatcatgacacatcagaaaaa
attgcggtgaaaatgtgtcgcctggagttgacagcaagaaacaaagacagatggagcaga
gagatccagatcatgaaaaagttgagtaatctcaatgtagtgacagccagagacgtgcca
gaggagatgaagcacattgccttaaacgatcttccactgctggccatggagtactgttcc
aagggagacctcagaaagatgctgagcaagcctgaaaattgctgtggactgaaagaaagt
gaagtactttccctgctcaatgacgttggttcaggcatccagtatttgcatgaaaacaag
atcatacacagagaccttaaaccagaaaacatagtgctccaggaagtcaatggaaagttg
gttcacaaaattatagacttgggctatgccaaagacttggaccaggggagtctgtgcact
tcatttgtgggaacactgcaatacctggcccctgaattatttgagaataagccttacact
gtcacagtggactactggagttttggcacaatgatatttgaatgcagttgtgggttccgg
ccttttctgcacaatcttcagcctgtccagtgggccagcaaagtgcggaacaaaggtccc
aaagacatcatggctgtggaggaattgaatggggaagtccgattctccacacatttacca
taccccaacaatctgagcaggacactcctggagcccatggagatgctgctgcagctgatg
ctgaaatgggaccctgtccagagaggaggcaagactaacgctgacagcaagaaacccctg
tgctttgaagtgctggaacagatattatgcatgagggttgtccacatcctgaacatgacc
acggcccaggtccactcattccagctggccccagatgagagcctccatagcctgcagcgc
cgcatcgagactgagaccaagatcgagttggtcaaccaggagctgctgcaggagacaggg
gtgtcgctggaccccaggaagcccgcagcccagtgtgtcctcgagggggtgcgaggctgg
gacagttacataatctatttgtttgacaagagtctcaccaagtactctggtcccttcagt
gctagacagctgcctgataaagtcaacactattgtgcgggaggctaagtctcagctgccc
ctggtggtgctgaagaaggtgtggggcgaggcggtgagctacatctgtggattgaaggac
gactacagtagactgttccagggccagagagctgccatgctgagcctcctgcgctacaac
accaacctgacccggtgcaagaacggcatgtttgccttctcccagcagctgaaggccaag
ctggacttcttcaagagcagtatccagtacgacctggagaagtacagcgatcagatgcac
tatgggatctcctctgagaagatgctgaaagcttggcaggagaatgaggagaaggcggct
gcatatgcacaggtggccgaggtgagccacctggacgaggaaatcatgtcgttacactca
gagatcgtggagctgcagaggagtccctacgctcgtcgccaaggagacatcatggagcag
ctggaggacaaggcgattgaactctacaaacaactaaaaatgaaatgccgaacacctgac
cctggtgtgagcagtgacagctcagagatggttaaagccattatacagactgtccagaac
caggacaaggtcctgagagacctctacacacacctcagtaagatcttattgagcaagcag
aagatcattgacctgttcccgcgcatcgagaagacactggagaacatcaaggatgccgac
aacaccgtgatgcagatgcagattaagagacagagagagttctggcacctattgaagatt
gcctgtgctcagaattctgcaaggaactcgatagcagccagcccagagtcgtccaaccct
ctgcaggtgtcccagtgggcccagtctgcccagcccatcagctcccctcacccactcacc
tccctacctggacccaatgacagtgatgctgccccacgactgcttcaggagaaccagaag
tacctcagtcagctgaccagcctgatgcaagaagctgctgacgagcagtccaaaagcgta
gtggaccaagattggagctggactaaatatgaaacgtctacaaaactgcaaaaacgaaat
gtgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112263933
Entry
112263933         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: inhibitor of nuclear factor kappa-B kinase subunit beta-like
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04623  Cytosolic DNA-sensing pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112263933
   04068 FoxO signaling pathway
    112263933
   04150 mTOR signaling pathway
    112263933
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112263933
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112263933
   04621 NOD-like receptor signaling pathway
    112263933
   04622 RIG-I-like receptor signaling pathway
    112263933
   04623 Cytosolic DNA-sensing pathway
    112263933
   04625 C-type lectin receptor signaling pathway
    112263933
  09152 Endocrine system
   04910 Insulin signaling pathway
    112263933
   04920 Adipocytokine signaling pathway
    112263933
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112263933
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112263933
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112263933
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     112263933
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   112263933
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr Pkinase_fungal TBK1_ULD ubiquitin Kdo APH Glyco_hydro_65m E2R135
Other DBs
NCBI-GeneID: 112263933
NCBI-ProteinID: XP_024296327
LinkDB
Position
12
AA seq 804 aa
MSRVPLQQQQSCGSWELKERLGTGGFGNVTRWQNKDTEEQIAIKQCRQELSERNRERWCL
EIQIMKRLDHVNVVAAREVPEGLQSSLRINDLPLLAMEYCQGGDLRKYLNLLENCCGMRE
GSILILLRDISSALTYLHKKRIIHRDLKPENIVLQQGEKRLIHKIIDLGYAKELDQNSLC
TSFVGTLQYLAPELLERQKYTVTVDYWSFGTLVFECITGFRPFLPTWQPVPWHSKLKLKQ
DHDIVVYEDLTGEVRFSKHLPQPNNLNTLLLGRLESWLQLMLRWSPQERGKADPQTTSSD
CFSQLETILELKLVHVLNMVSAKIFTYSVSANESVADLQQRIGSDTNIPPANQELLLEAG
LALEPQGEAGQCAIDYTEIDGRRTDLPLVFLFDRSSCTYEPQFTPRTMPENIRFVQTDPK
HVLSYSPLRRTWGQAWDTIRTLKEDWQRLQQGQKAALMSLLRHNSSLSKQKNEMVSMNQR
LTAKLDFFSTSLHIDMDKYQEQRATGIASEKLLGVWREMEQTAVSCGQAERVIELDEEMM
LLQTDIVDLQRQPWRSGEALDTLEGKAMELFRKLKEKPRGWFTTSPFITIYHHSIDFCCL
LMILRTCHYRLENFAPLSRSLSSPRLSLFISPLSLSPLSSTHHICVFTLPAVRTSVCVCV
AVKTVVCRQRVMELLPRVEGVVQRMAESEQVLMNLQERRQRELWNLLKVACVSLVVIQSK
VRSPVSGSPVDGGRSSSSVPPLLTPRPSLQQLDESLLVIEESRTFESRLQSLIQETIQES
ESDMQLLREWTWLSEGQDLSSDLS
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgagtcgcgttcccctgcagcagcagcagagctgtggctcctgggagctgaaggaacgc
ctggggaccggaggcttcgggaatgtcacccgatggcagaacaaggacacagaggagcag
atagccattaagcagtgtcgtcaggagctgagtgagaggaacagagaacgctggtgtttg
gagatacagatcatgaagagactggaccatgtgaatgtggtagcagcgagggaggttcct
gaagggctgcagtcctccttacgcatcaatgatctacctctactggccatggagtactgt
cagggaggtgacctgaggaagtatctgaacctgttggagaactgctgtggaatgagggag
ggttccatccttattctgctacgggacatatcctctgctctgacctaccttcataagaag
aggatcatccacagagatctgaagccagagaacatcgtcctccagcagggagagaagaga
ttgatccataagatcatagatctgggctacgccaaggaactggaccagaacagtctgtgt
acatcattcgttggaacactgcaatacctggctccagagctcttggagagacagaagtat
acagtgactgtggattattggagctttggtacattggtgtttgagtgcatcactgggttc
cggccttttctgccaacctggcaacccgtgccctggcatagtaagttgaagttgaagcag
gatcatgacattgtggtttatgaggacctgacaggggaggtgcgcttctctaaacacctt
ccccagcccaacaacctcaacactctgttgttgggccgtctagaaagctggctgcagctg
atgctgaggtggtctccccaggagagaggcaaggcagacccccagaccacttcctcagac
tgcttctctcagctagagactatactggagctgaagctggttcacgtattgaacatggtg
tctgctaagatcttcacctactctgtctcagccaatgagagcgtggctgatctgcagcag
cgaatcggttctgacaccaacatccctccagccaatcaagagctactgttggaggcggga
ctagccctggagccacagggagaggcggggcagtgtgccatcgactacactgagatagac
gggaggaggacagaccttcctctggtgttcctgtttgaccgttcctcctgcacctacgag
ccccagttcaccccccgcacaatgccagagaacatacgctttgtccagacagatcctaag
cacgtgttgtcttacagtcctctgaggaggacctggggccaggcctgggacaccatccgc
accctgaaggaggactggcagaggttacagcagggacagaaagctgctctcatgagtttg
ctgagacacaacagctccctgtcgaagcagaagaatgagatggtatctatgaaccagagg
ctgacggccaaactagacttcttctctaccagcctgcacatagacatggacaaataccag
gagcagagagctacagggatagcctctgaaaagctgctgggtgtgtggagggagatggag
cagactgcagtcagctgtggccaggcagagagggtgatagagctggacgaggagatgatg
ctcctccagacagacatcgtggacctccagagacaaccgtggaggagtggagaggccctg
gacacacttgaggggaaggccatggagttgttccgtaagctgaaagagaaacctagaggt
tggtttaccacttctccattcatcaccatttaccatcacagtatagacttctgctgtcta
cttatgattctgagaacatgtcattatagactggaaaacttcgctcccctctcccgctct
ctctcctccccccgtctgtctctgtttatatctcctctctctctctctcctctatcttct
acacaccacatttgcgttttcactctccctgcagtacgaacaagtgtgtgtgtttgtgtt
gcagttaagacggtggtgtgtcgtcagcgtgtaatggagctgctaccccgtgtagagggc
gtggtacagagaatggctgagagtgaacaggtcctgatgaatctacaggagaggaggcag
agggaactatggaacctgctgaaagtagcttgtgtatccttggttgttattcagagtaag
gtgcgcagcccggtgagtgggagtcctgtggatgggggacgctcttcctcctctgttccc
cctctactgacccccagacccagcctacagcagctggatgagtctctgttggtgatcgag
gagagcaggacgtttgagagtcgactacagagtctgatacaggagaccatccaggagtct
gaaagcgatatgcagttgctgagagagtggacgtggctgagtgaaggacaggacctttcc
tctgatctttcctga

DBGET integrated database retrieval system