KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224096Help
Entry
112224096         CDS       T05605                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:otw01002]
    112224096
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112224096
   04090 CD molecules [BR:otw04090]
    112224096
Enzymes [BR:otw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     112224096
Peptidases [BR:otw01002]
 Metallo Peptidases
  Family M2
   112224096
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112224096
CD molecules [BR:otw04090]
 Proteins
  112224096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 112224096
NCBI-ProteinID: XP_024243168
LinkDB All DBs
Position
25
AA seq 1288 aa AA seqDB search
MARMLWAAVVLVLPLLGLCQFVLPPEWVPEDYPATEVGAESFVTAYNTTAELVTYQNQEA
SWTYQTNITAHNSNKKVESDGLKQAFTEAWGKKAKETFSDMLVATFNDTLQRRIKKINVL
GAANLPAGERHEYNVILSKMSEIYSTAKVCPKPDDCWSLEPELTEIMANSRSYKTLLYAW
EGWHNASGVPLKAEYPTFVELSNKAYKADGFDDTGEYWRSWYESPTFESDLEAIYKQIQP
LYQNLHAFVRRKLYNHYGPKYINLKGPIPAHLLGNMWAQTWNNIYGMMIPFPGKPNVDVT
DEMMAQNWNATHMFRVAEEFFTSLGLIKMPQEFWDKSMLEKPENREVVCHASAWDFYNRK
DFRIKQCTTVNMQQLFTVHHEMGHVEYYLQYKELPYSFRRGANPGFHEAIGDVMSLSVST
PKHLASIGLLPNVTNDNESDINYLLKMALEKIAFLPFGYLIDQWRWSVFSGRTPPERYNA
DWWHLRTKYQGICPPTKRTEEHMDAGAKYHIPGNTPYIRYFVSFILQFQFHKKLCQAANQ
SGPLHTCDIYQSKEAGKILETVLKSGESKPWTQVLQEAVGTNQMDASALMEYFGPIITWL
EEQNAATNETLGWPDFNWVPPVPEGYPEDIDKIADEVQAKKFLEEYNSTSEGVWNAYTEA
SWAYNTDINEENKQNMLQKNLDMSIHTLTYGKEARKYDTTDFQDGSVKRILKKLSDIERA
GLPDEELKEYNILLANMETKYSVAQVCRANGTCHPLDPDLQQIMAESRDYNELLFAWQGW
RNASGRELRQDYKRYVQLANKAATLNGHSDNGAFWRSLYETPTFEEDLEHLWKELEPLYL
NVHAYVRRSLYKKYGGKHINVRGPIPAHLLGNMWAQTWSGIMDLAIPYPDATQVDATPAM
IAKGWNATRMFQESDNFFTSLGLLPMPPEFWAKSMLEKPKDGRNVVCHASAWDFYNRKDF
RIKQCTVITMDDLITVHHEMGHVQYFLQYKDQPISFREGANPGFHEAIGDVLALSVATPK
HLKEIGLLDVVEDNAESTINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRISEEEYNKEW
WNMRMKYQGLCPPVARTEQDFDPGAKFHIPANVPYVRYFVSFIIQFQFHQALCNAAGHVG
PLHDCDIYRSKEAGKLLGDVMKVGFSKPWPETMAMITGKSIMSAKPLVEYFKPLTDWLEA
ENNKNDEVRGWPEYDWKPPSDSSETSPPAPEEGKVDFLGMSLDGAGAAAGQWVLLVLGLV
LLVATILLGYMYKKSKRRNLSSSELELK
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atggccagaatgctttgggcagcggtggtgctggtactgccactcttgggactctgtcaa
tttgtcctgccacccgagtgggtgccagaggactaccctgccacagaggtcggcgctgaa
agctttgtcactgcctacaataccaccgccgagcttgtcacctaccaaaaccaagaggcc
agctggacataccagaccaacattacggcccacaactccaacaaaaaggtggaatctgat
gggttaaagcaggccttcacagaagcctgggggaagaaggccaaagaaaccttctctgat
atgctggtggccacctttaatgatactctgcagaggcgtatcaagaagatcaacgttctg
ggagcggctaacttacctgcaggagaaagacatgagtacaacgtcatactaagcaagatg
tctgaaatatactctactgccaaagtgtgtccaaagccagatgactgctggtctcttgag
ccagagctgacagagatcatggccaactcacggagctacaagacactgctgtacgcttgg
gagggttggcacaatgcatcgggtgtgccactcaaggcagagtatccaacgtttgtggag
cttagcaacaaggcctataaagctgatggttttgatgacacgggagaatactggcgttcg
tggtacgagtcaccgactttcgagagtgacctggaggctatttacaaacagatacagccg
ctttaccagaatcttcacgcctttgtgcgccgcaagctctacaaccactacggcccgaaa
tacatcaatcttaaaggacctatccctgctcatctgctaggaaacatgtgggcacaaacc
tggaacaacatctatggcatgatgatccccttccccggcaaacccaatgtggacgtgaca
gatgaaatgatggcccaaaactggaatgctactcatatgttccgggtggctgaggagttc
ttcacatccctgggactcatcaaaatgccccaagagttctgggacaagtctatgttggag
aagccagagaatcgggaggtggtgtgccacgcatctgcctgggacttctacaatagaaag
gacttcaggatcaaacagtgcaccacagtcaacatgcagcagcttttcacagtgcaccac
gagatgggccatgttgaatactacttgcagtacaaggaactgccttatagcttccgccgc
ggggctaacccaggtttccatgaggcaattggtgatgtcatgtccctctctgtgtccacg
cctaagcatctggctagcatcggcctattgcccaatgtgaccaatgacaacgagagcgac
atcaactacctgctgaaaatggctctggagaagatagcctttctccccttcggctatctc
attgaccagtggaggtggagtgtgtttagtgggcgcacccccccagagcgctacaacgca
gactggtggcacctcaggacaaaataccagggtatctgtcctcccaccaaacgcacagag
gagcacatggatgctggagccaaataccacattccaggaaacaccccatacatcagatac
tttgtgagcttcattctgcagttccagttccacaagaagctatgtcaggcagccaatcag
agtggacccctgcacacatgtgacatctaccagtccaaggaggcgggaaagattttagag
acggtccttaaatccggagaatcaaagccctggacacaggtgctccaggaagccgtcgga
acaaaccagatggacgccagtgccctgatggaatactttggtcccatcatcacatggctg
gaggaacagaatgcagcgacgaatgagaccctgggctggccagactttaactgggttcca
cctgtaccagagggctaccccgaggatattgacaagattgcagatgaggtgcaggctaag
aagttcctggaagagtacaacagcacttctgagggggtctggaatgcctacactgaagca
tcgtgggcctacaacactgacatcaatgaggagaacaagcagaatatgctgcaaaagaac
ttggacatgtctatccacacactgacctacggaaaagaggcccgcaagtatgacaccaca
gactttcaggatggttctgtgaagcgtatcctgaagaaactcagtgacatcgaaagagca
ggacttcccgacgaggaactgaaagagtacaacattctgctggcgaacatggagaccaag
tacagtgtggctcaggtgtgcagagctaatgggacttgccatccactggacccagacctc
cagcagattatggctgagtccagagactataatgagctgttatttgcctggcagggctgg
agaaacgcctctggcagagaactgcgacaggactacaagagatatgttcaactggccaac
aaagctgccactcttaatggacactctgataacggggcattctggcgctccctgtacgag
acccccaccttcgaagaggacctggagcatctgtggaaggagctggagcccctctatctc
aacgtgcatgcctacgtgcgcaggtctctctacaaaaagtatgggggcaaacacatcaac
gtgagagggcccattcctgcccatcttctaggtaacatgtgggcgcagacctggtctggc
atcatggacttggccattccctaccccgatgccacacaagtagacgccacaccagccatg
atagccaagggctggaatgccaccaggatgttccaagagtcagacaacttcttcacttct
ctggggctgctgcccatgcctccagagttctgggccaagtccatgctggagaaacccaag
gatggacgcaatgtggtgtgtcatgcctccgcctgggacttctacaaccgcaaagacttc
aggatcaaacagtgcaccgtgataaccatggatgacctcatcaccgttcaccatgagatg
ggtcatgtgcagtacttcctgcagtacaaggaccagcccatctccttccgcgaaggcgcc
aatccaggtttccacgaggccatcggtgatgtgctggccctgtctgtcgcgactcccaag
catctaaaggagattggtttactggatgtggtggaggacaacgcagagagtacgatcaat
tacctcatgagcatcgccctggacaaaatagccttcctgcccttcggctacctgatggac
cagtggaggtggaaagtgtttgacggacgcatctctgaggaggagtacaacaaggaatgg
tggaatatgagaatgaagtaccagggcttgtgtccacctgtggcccgcactgagcaggac
tttgacccaggtgcaaagttccacatccctgctaatgtgccttatgtcaggtactttgtg
agcttcatcatccagttccagttccaccaggctctgtgtaacgccgccgggcatgtcggc
cctctccacgattgtgatatctaccgctccaaagaggcagggaaacttctaggtgacgtg
atgaaagtgggtttcagtaagccctggcctgaaacgatggccatgatcactggaaagtcc
atcatgtctgccaagccactggtggagtacttcaaacctctcactgactggctggaagca
gagaacaacaagaacgatgaggtcagaggctggcctgaatacgactggaaaccaccaagt
gacagctcagaaacgtcccccccagccccagaagagggtaaagttgacttccttgggatg
agtctggacggtgcaggagctgcagcaggccagtgggtcctactggtcctgggtctggtg
cttctagtggccaccatcctcctgggctacatgtacaagaaatcaaaacggagaaatctg
tcctcatctgagctggagctgaagtga

DBGET integrated database retrieval system