KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224408
Entry
112224408         CDS       T05605                                 

Definition
(RefSeq) casein kinase I-like
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112224408
   04340 Hedgehog signaling pathway
    112224408
   04068 FoxO signaling pathway
    112224408
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112224408
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112224408
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112224408
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   112224408
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112224408
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 112224408
NCBI-ProteinID: XP_024243712
LinkDB
Position
25
AA seq 421 aa
MELRVGNKYRLGRKIGSGSFGDIYLGINIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRT
AEDGERERERERREGKEGDERIGGGPRVPRALPPGGNPPGGVDRIRNGPNAAASNPASRG
VAQSGNRSPQAVSRAERERKVAMRLHRGAPANISSSDLTAQMGQSRIATSQVSVPFEHLG
K
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggaactgagagtggggaacaagtaccgcctcggcaggaagatagggagcggctctttt
ggagacatttacctgggcattaacatcgccacgggtgaggaggtggccattaagctggaa
tgtgtgaagaccaaacacccacaactccacatcgagagcaagttctacaagatgatgcag
ggaggagtgggcatcccatccataaagtggtgtggagcagagggagactacaacgtgatg
gtgatggagctgctaggccccagtctggaggatctgttcaacttctgctcccgcaagttc
agcctcaagactgtcctgctgctggctgaccagatgatcagccgtattgagtacatccac
tctaagaacttcatccacagagatgtgaagcctgacaacttcctgatgggcctgggcaag
aagggcaacctggtgtacatcattgactttggcctggccaagaagtaccgcgacgcccgc
acacaccagcacatcccctaccgcgagaacaagaacctgaccggcacggcacgctatgca
tccatcaacacacacctggggatagagcagtctcgtcgtgatgacctggagtctcttggt
tacgtcctgatgtacttcaacctgggctctctgccctggcagggcctcaaggccgccacc
aagaggcagaagtacgaacgcatcagtgagaagaagatgtccacccctattgaggtgctc
tgcaagggatacccatctgagttctccacctacctgaacttctgtcgctctctgcggttc
gatgacaagccggactactcatacctgagacagctgttcagaaacctattccacagacaa
ggcttctcctacgactatgtctttgactggaacatgctcaagtttggggccagcaggaca
gccgaggatggggagagggagagggagagggagaggagagagggaaaagagggtgatgag
aggatcggcgggggacctagggtgcctcgtgccctacccccgggcggcaaccccccggga
ggtgtagacaggatcagaaatggccccaatgcagcagcctctaaccctgcttccagagga
gtcgcacagtcaggaaaccggtccccacaggccgtgtcccgtgcggagcgagagagaaag
gtggccatgaggctccaccgtggcgcccccgccaacatctcctcctctgacctcactgca
cagatgggccagtcacgcatcgccacatcacaggtcagtgtgccatttgaacacctgggg
aagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226146
Entry
112226146         CDS       T05605                                 

Definition
(RefSeq) casein kinase I
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112226146
   04340 Hedgehog signaling pathway
    112226146
   04068 FoxO signaling pathway
    112226146
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112226146
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112226146
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112226146
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   112226146
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112226146
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 112226146
NCBI-ProteinID: XP_024246203
LinkDB
Position
27
AA seq 415 aa
MDLRVGNKYRLGRKIGSGSFGDIYLGANIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRT
AEDGERRGADERDERIVGGPRGSAARGLPPGPNPPAANRVRNGAEQAISNPASRVQQSGN
TSPRAISRAERERKVSMRLHRGAPANVSSSDLTARLDQSRISTSQVSMPFEHLGK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggatctgagagtggggaacaagtaccgactgggacggaaaatagggagtgggtccttt
ggagacatttaccttggtgccaacattgccacgggcgaggaggtggccattaagctggaa
tgtgtgaagaccaaacacccacagctgcacatcgagagcaagttctacaagatgatgcag
ggaggagtggggattccctcgataaagtggtgcggggcagagggagactacaacgtcatg
gtgatggagctcctgggccccagtctggaagacctcttcaacttctgttcccgcaagttc
agcctcaaaacggtgctactgctggcagaccagatgatcagtcgcatcgagtacattcac
tccaagaacttcatccatcgcgacgtcaagcccgacaacttcctcatggggctggggaag
aagggcaacctggtatacatcatcgactttggcctggccaagaagtacagagacgcccgc
acacaccagcacatcccctacagggagaacaagaacctgacgggcactgcacgctacgcg
tccatcaacacccacctgggcatcgagcagtctcggcgtgacgacctggagtctctggga
tatgtcctcatgtacttcaacctgggctctctgccctggcaaggcctcaaagccgccaca
aagagacagaagtacgaacgcatcagcgagaaaaagatgtccacccccatcgaggtgctc
tgcaaaggatacccctccgagttctccacctacctgaatttctgccgctcgttgcgcttt
gacgacaagccagactactcataccttcgtcagctcttcaggaatctgttccacagacaa
ggcttctcctatgactacgtattcgactggaacatgctcaaatttggtgccagtaggaca
gcagaagacggtgagaggaggggagctgatgaaagggacgagcgtatcgtaggaggccct
cggggatctgctgcacggggtctcccgccagggccaaacccaccagccgccaacagagtt
aggaatggagctgagcaggccatctctaaccctgcatcacgggtgcagcagtctgggaac
acgtcgccgcgggctatctctcgcgctgagcgtgagcggaaggtgagcatgcggctccac
cgaggagcccccgcaaacgtgtcatcctctgacctcacagcccgtcttgaccaatcccga
atttccacatcgcaggtcagcatgccatttgagcacctggggaagtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258765
Entry
112258765         CDS       T05605                                 

Definition
(RefSeq) casein kinase I-like
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112258765
   04340 Hedgehog signaling pathway
    112258765
   04068 FoxO signaling pathway
    112258765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112258765
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112258765
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112258765
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   112258765
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112258765
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 112258765
NCBI-ProteinID: XP_024289092
LinkDB
Position
1
AA seq 414 aa
MELRVGNKYRLGRKIGSGSFGDIYLGVNIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRT
AEDGERERREADERIGGGPRAPRALPPGVNPPGGVDRIRNGPNAAASNPASRGVPQSGNR
SPQAVSRAERERKVAMRLHRGAPANISSSDLTAQMGQSRIATSQVSVPFEHLGK
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggagctgagagtgggaaacaagtaccgcctcggcaggaagataggaagtggctctttt
ggagacatttacctgggtgttaacattgccacgggtgaggaggtggccattaagctggaa
tgtgtgaagaccaaacacccacaactccacatcgagagcaaattctacaagatgatgcag
ggaggagtgggcatcccgtccataaagtggtgtggagcagagggagactacaacgtgatg
gtgatggagctgctaggccccagtctggaggacctgttcaacttctgctcccgcaagttc
agcctcaagactgtcctgctgctggctgaccagatgatcagccgtattgagtacatccac
tctaagaacttcatccacagagatgtgaagcctgacaacttcctgatgggcctgggcaag
aagggcaacctggtatacatcatcgactttggcctggccaagaagtaccgcgacgcccgc
acacatcagcacatcccctaccgcgagaacaagaacctgaccggcaccgcgcgctacgca
tccatcaacacacacctggggatagaacagtctcgtcgtgatgacctggagtctctgggt
tatgtcctgatgtacttcaacctgggctctctgccctggcagggcctcaaggccgccacc
aagagacagaagtacgaacgcatcagtgagaaaaagatgtccacccctatcgaggtgctc
tgcaagggatacccctctgagttctccacctacctgaacttctgtcgctctctgcggttt
gatgacaagccagactactcatacttgagacaactattcagaaacttgttccacagacag
ggcttctcctacgactacgtctttgactggaacatgcttaagtttggggccagcaggaca
gccgaggatggggagcgggagaggagagaggcggatgagaggatcgggggaggacctagg
gcaccccgtgccctacccccgggcgtcaacccccctgggggagtagacaggatccgaaat
ggccccaatgcagcagcttctaaccctgcctccagaggagtcccacagtcagggaaccgg
tcaccgcaggctgtgtcccgtgcagagcgagagaggaaggtggccatgaggctccaccgc
ggcgcccctgctaacatctcctcctctgatctcaccgcacagatgggccaatcacgcatc
gccacatcacaggtcagcgtgccatttgaacacctggggaagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258792
Entry
112258792         CDS       T05605                                 

Definition
(RefSeq) casein kinase I-like
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112258792
   04340 Hedgehog signaling pathway
    112258792
   04068 FoxO signaling pathway
    112258792
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112258792
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112258792
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112258792
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   112258792
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112258792
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 112258792
NCBI-ProteinID: XP_024289143
LinkDB
Position
9
AA seq 415 aa
MDLRVGNKYRLGRKIGSGSFGDIYLGANIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRT
AEDGERRGADERDERIVGGPRGSAARGLPPGPNPPAINRVRNGPEQAISNPASRVQQSGN
TSPRAISRAERERKVSMRLHRGAPANVSSSDLTARLDQSRISTSQVSMPFEHLGK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggatctgagagtggggaacaagtaccgactgggacggaaaatagggagtggctccttt
ggagacatttaccttggtgccaacattgccacgggtgaggaggtggccattaagttggaa
tgtgtgaagaccaaacacccacagctgcacatcgagagcaagttctacaagatgatgcag
ggaggagtggggattccctcgataaagtggtgcggggcagagggagactacaacgtcatg
gtgatggagctcctgggccccagtctggaagacctcttcaacttctgttcccgcaagttc
agcctcaaaacggtgctactgctggcagaccagatgatcagtcgcatcgagtacatccac
tccaagaacttcatccatcgcgacgtcaagcccgacaacttcctcatggggcttgggaag
aagggcaacctagtgtacatcatcgactttggcctggccaagaagtacagagacgcccgc
acacaccagcacatcccctacagggagaacaagaacctgacgggcactgcacgctacgcg
tccatcaacacccacctgggcatcgagcagtctcggcgtgatgacctggagtctctggga
tatgtcctcatgtacttcaacctgggctctctgccctggcaaggcctcaaagccgccaca
aagaggcagaagtacgaacgcatcagcgagaaaaaaatgtccacccccatcgaagtgctc
tgcaaaggatacccctccgagttctccacctacctgaatttttgccgctcgttgcgcttt
gacgacaagccagactactcataccttcgtcagctcttcaggaatctgttccacagacaa
ggcttctcctatgactacgtattcgactggaacatgctcaaatttggtgccagtaggaca
gcagaagacggtgagaggaggggagctgacgaaagagacgagcgtatcgtaggaggccct
cggggatccgctgcacggggtctcccgccagggccaaacccaccagccatcaacagagtt
aggaatggaccagagcaggccatctctaaccccgcctcacgggtgcagcagtctgggaac
acatcgccgcgggctatctctcgcgctgagcgtgagcggaaggtgagcatgcggctccac
cgaggagcccccgcaaatgtgtcatcctctgaccttacagcccgtcttgaccaatcccga
atttccacatcgcaggtcagcatgccatttgagcacctggggaagtga

DBGET integrated database retrieval system