KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224481
Entry
112224481         CDS       T05605                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04145  Phagosome
otw04310  Wnt signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112224481
   04310 Wnt signaling pathway
    112224481
   04370 VEGF signaling pathway
    112224481
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112224481
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112224481
   04520 Adherens junction
    112224481
   04530 Tight junction
    112224481
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112224481
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112224481
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112224481
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112224481
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112224481
   04031 GTP-binding proteins [BR:otw04031]
    112224481
Membrane trafficking [BR:otw04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    112224481
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    112224481
  Macropinocytosis
   Ras GTPases
    112224481
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    112224481
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112224481
  Exosomal proteins of other body fluids (saliva and urine)
   112224481
  Exosomal proteins of colorectal cancer cells
   112224481
  Exosomal proteins of bladder cancer cells
   112224481
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112224481
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 112224481
NCBI-ProteinID: XP_024243827
LinkDB
Position
25
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCSLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgttgtagtgggggacggagctgtgggtaaaacatgcctgctc
atcagctacaccaccaacgcgttccccggggaatacatccccacagtctttgacaactac
tctgccaatgtgatggtagatgggaaaccagtgaatctgggtctatgggatacagcagga
caggaagactacgacagactcagaccactgtcctatccacagacggatgtgtttttgatc
tgtttctctctcgtgagtcctgcctcctttgaaaacgtccgtgccaagtggtacccagag
gtgagacaccactgccccaacaccccaatcatcctggtgggcaccaagctggatctgaga
gatgacaaggacaccatcgagaagctgaaggagaagaaactcacccccattacctacccc
cagggtctggccatggcaaaagagattggagcagtaaagtacctggaatgctcagccttg
acacagcgtggccttaagacagtgtttgacgaagccatccgggcggtcttgtgtcccccg
cccgtcaagaagaggaagagaaagtgttcactactctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224482
Entry
112224482         CDS       T05605                                 

Gene name
rac3
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3 isoform X1
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04310  Wnt signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112224482 (rac3)
   04310 Wnt signaling pathway
    112224482 (rac3)
   04370 VEGF signaling pathway
    112224482 (rac3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112224482 (rac3)
   04520 Adherens junction
    112224482 (rac3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112224482 (rac3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112224482 (rac3)
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112224482 (rac3)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 112224482
NCBI-ProteinID: XP_024243828
LinkDB
Position
25
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIERLRDKKLSPITYPQGLAMAREIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRGKRCTVF
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaagcaattaaatgcgtggtggtcggcgacggggccgtgggtaagacctgtctgctg
atcagctacaccaccaatgccttccccggagagtacatacccactgtctttgacaactac
tctgccaatgtgatggtagatgggaaaccagtgaatctgggtctatgggatacagcagga
caggaagactacgacagactcagaccactgtcctatccacagacggatgtgttcttgata
tgcttctccttggtcagcccggcctcctttgagaacgtccgagctaagtggtaccctgaa
gtgagacaccactgccccaacaccccaatcatcctggtgggcaccaagctggatctgaga
gatgacaaggacaccatcgaaaggctgagggacaagaagctgtcccccatcacctacccc
cagggtctggccatggcacgggagataggtgctgtgaagtacctggagtgctctgccctg
acccagcgagggttgaagactgtgtttgacgaggccatccgcgccgtgctctgcccccca
cccgtcaagaagaggggcaagaggtgcaccgtgttctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234040
Entry
112234040         CDS       T05605                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2-like
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04310  Wnt signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112234040
   04310 Wnt signaling pathway
    112234040
   04370 VEGF signaling pathway
    112234040
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112234040
   04520 Adherens junction
    112234040
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112234040
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112234040
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112234040
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 112234040
NCBI-ProteinID: XP_024257774
LinkDB
Position
Unknown
AA seq 196 aa
MLCMCWHTLIAQSLFQCCGQECLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLW
DTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPSTPIILVGTK
LDLRDEKETIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAV
LCPQPTKVKKRPCLLI
NT seq 591 nt   +upstreamnt  +downstreamnt
atgttgtgtatgtgttggcacacactgattgcccaaagtctgtttcagtgctgtggacaa
gaatgcctgctcatcagctacacaaccaacgccttccctggagagtacatccccacagtg
tttgataactactcagccaatgtgatggtggacagtaagccagtgaacctgggactgtgg
gatacagcaggacaggaggactatgacagactcagacctctgtcctatcctcagacggac
gtgttcctcatctgtttctctctggtgagcccagcatcgtttgagaacgtcagagccaag
tggtaccctgaggtacgacaccactgcccctccacacccatcatccttgtgggcaccaag
ctggatctgagggacgagaaggaaaccattgagaagctgaaggagaagaagctagcgccc
atcacctacccacaaggcttagcactagccaaagagatagactctgtgaagtacctggaa
tgctctgccctgacccagcgggggctgaaaacggtctttgacgaggccatccgagcggtg
ctgtgcccccagcccaccaaggtgaagaaacgaccctgtctactcatctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239957
Entry
112239957         CDS       T05605                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1-like isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04145  Phagosome
otw04310  Wnt signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112239957
   04310 Wnt signaling pathway
    112239957
   04370 VEGF signaling pathway
    112239957
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112239957
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112239957
   04520 Adherens junction
    112239957
   04530 Tight junction
    112239957
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112239957
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112239957
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112239957
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112239957
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112239957
   04031 GTP-binding proteins [BR:otw04031]
    112239957
Membrane trafficking [BR:otw04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    112239957
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    112239957
  Macropinocytosis
   Ras GTPases
    112239957
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    112239957
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112239957
  Exosomal proteins of other body fluids (saliva and urine)
   112239957
  Exosomal proteins of colorectal cancer cells
   112239957
  Exosomal proteins of bladder cancer cells
   112239957
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112239957
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 112239957
NCBI-ProteinID: XP_024264101
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLREKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRRRKCSLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccataaagtgtgtcgtggttggggacggagctgtgggtaagacatgtctgctg
atcagctacacgaccaacgccttccctggagagtacatccccacagtgtttgacaactac
tctgccaatgtgatggtggatggaaaaccagtcaacctgggcctttgggatacagcagga
caggaggactacgacagactccgccccctctcctacccacagacggatgtgttccttatc
tgtttctccctcgtgagtcctgcctcgtttgaaaacgtccgtgccaagtggtacccagag
gtcaggcaccactgccccaacacgcccatcatcctagtgggcaccaagttggatctgagg
gacgataaggacaccatcgagaagctcagggagaagaagctcacccctatcacctacccc
cagggcctggccatggccaaagagatcggtgcggtgaagtacctggagtgctcggccctg
acccagcgcggcctgaagactgtgtttgacgaggccatccgggcggtcctctgccccccg
cccgtcaagaagaggagaaggaagtgctccctgctctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112240485
Entry
112240485         CDS       T05605                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04310  Wnt signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112240485
   04310 Wnt signaling pathway
    112240485
   04370 VEGF signaling pathway
    112240485
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112240485
   04520 Adherens junction
    112240485
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112240485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112240485
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112240485
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 112240485
NCBI-ProteinID: XP_024264535
LinkDB
Position
Unknown
AA seq 136 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWYPEVRHHCPSTPIILVGTKLDLR
DEKETIEKLKEKKLAP
NT seq 409 nt   +upstreamnt  +downstreamnt
atgcaggctatcaaatgtgttgttgtgggagatggagctgtggggaaaacatgtcttctc
atcagctacacaaccaacgctttccctggagaatatatccctactgtctttgataactac
tcagccaatgtgatggtggacagtaagccagtcaatctgggtctctgggatacagcagga
caggaggactatgacagacttagaccactgtcctacccacagacggacgtgttcctcatc
tgtttctctctggtgagcccagcctcctacgagaacgtcagagccaagtggtacccagag
gtgcgtcaccactgcccgtcaacccctatcatcctagtgggtactaagctggatctgagg
gacgagaaggagaccatcgagaagctcaaagagaagaaactggccccca

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258954
Entry
112258954         CDS       T05605                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2-like
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04310  Wnt signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112258954
   04310 Wnt signaling pathway
    112258954
   04370 VEGF signaling pathway
    112258954
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112258954
   04520 Adherens junction
    112258954
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112258954
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112258954
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112258954
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 112258954
NCBI-ProteinID: XP_024289394
LinkDB
Position
9
AA seq 175 aa
MPVISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDV
FLICFSLVSPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDEKETIEKLKEKKLAPI
SYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTKVKKRPCLLI
NT seq 528 nt   +upstreamnt  +downstreamnt
atgcctgtcatcagctacacaaccaacgccttccctggagagtacatccccacagtgttt
gataactactcagccaatgtgatggtggacagtaagccagtgaacctgggactgtgggat
acagcaggacaggaggactatgacagactcagacctctgtcctatcctcagacggacgtg
ttcctcatctgtttctctctggtgagcccagcatcgtttgagaacgtcagagccaagtgg
taccctgaggtacgacaccactgcccctccacacccatcatcctcgtgggcaccaagctg
gatctgagggacgagaaggaaaccattgagaagctgaaggagaagaagctagcgcccatc
tcctacccacaaggcttagcactagccaaagagatagactcggtgaagtacctggaatgc
tctgccctgacccagcgggggctgaaaacggtctttgacgaggccatccgagcggtgctg
tgcccccagcccaccaaggtgaagaaacgaccttgtctactcatctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112259175
Entry
112259175         CDS       T05605                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3-like isoform X1
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04310  Wnt signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112259175
   04310 Wnt signaling pathway
    112259175
   04370 VEGF signaling pathway
    112259175
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112259175
   04520 Adherens junction
    112259175
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112259175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112259175
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112259175
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 112259175
NCBI-ProteinID: XP_024289692
LinkDB
Position
1
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTTERLRDKKLSPITYPQGLAMAREIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRGKRCTVF
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaagcaattaaatgtgtggtggtcggggacggggctgtgggaaagacctgtttgcta
atcagctacaccaccaatgccttccccggagagtacatacccactgtctttgacaactac
tctgccaatgtgatggttgatgggaaaccagtgaatctgggtctatgggatacagcagga
caggaagactacgacagactccgaccactgtcctatccacagacggatgtgttcttgata
tgcttctccctggtcagccccgcctcctttgagaacgtccgagctaagtggtacccagag
gtgagacaccactgccccaacacccccatcatcctggtgggcactaaactggatctgaga
gatgacaaggacaccacggagaggctgagggacaagaagctgtcccccatcacctacccc
cagggcctggccatggcacgggagataggtgctgtgaagtacctggagtgctcggccctg
acccagcgagggttgaagacggtatttgacgaggccatccgtgctgtgctgtgcccccca
cccgtcaagaagaggggcaagaggtgcacagtgttctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112259231
Entry
112259231         CDS       T05605                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2-like
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04310  Wnt signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112259231
   04310 Wnt signaling pathway
    112259231
   04370 VEGF signaling pathway
    112259231
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112259231
   04520 Adherens junction
    112259231
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112259231
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112259231
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112259231
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 112259231
NCBI-ProteinID: XP_024289737
LinkDB
Position
9
AA seq 196 aa
MLCMCWHTLIAQSLFQCCGQECLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLW
DTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPSTPIILVGTK
LDLRDEKETIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAV
LCPQPTKVKKRPCLLI
NT seq 591 nt   +upstreamnt  +downstreamnt
atgttgtgtatgtgttggcacacactgattgcccaaagtctgtttcagtgctgtggacaa
gaatgcctgctcatcagctacacaaccaacgccttccctggagagtacatccccacagtg
tttgataactactcagccaatgtgatggtggacagtaagccagtgaacctgggactgtgg
gatacagcaggacaggaggactatgacagactcagacctctgtcctatcctcagacggac
gtgttcctcatctgtttctctctggtgagcccagcatcgtttgagaacgtcagagccaag
tggtaccctgaggtacgacaccactgcccctccacacccatcatccttgtgggcaccaag
ctggatctgagggacgagaaggaaaccattgagaagctgaaggagaagaagctagcgccc
atcacctacccacaaggcttagcactagccaaagagatagactctgtgaagtacctggaa
tgctctgccctgacccagcgggggctgaaaacggtctttgacgaggccatccgagcggtg
ctgtgcccccagcccaccaaggtgaagaaacgaccctgtctactcatctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112259508
Entry
112259508         CDS       T05605                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04145  Phagosome
otw04310  Wnt signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112259508
   04310 Wnt signaling pathway
    112259508
   04370 VEGF signaling pathway
    112259508
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112259508
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112259508
   04520 Adherens junction
    112259508
   04530 Tight junction
    112259508
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112259508
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112259508
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112259508
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112259508
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112259508
   04031 GTP-binding proteins [BR:otw04031]
    112259508
Membrane trafficking [BR:otw04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    112259508
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    112259508
  Macropinocytosis
   Ras GTPases
    112259508
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    112259508
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112259508
  Exosomal proteins of other body fluids (saliva and urine)
   112259508
  Exosomal proteins of colorectal cancer cells
   112259508
  Exosomal proteins of bladder cancer cells
   112259508
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112259508
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 112259508
NCBI-ProteinID: XP_024289964
LinkDB
Position
1
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCSLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgttgtagtgggggacggagctgtgggtaaaacatgcctgctc
atcagctacaccaccaatgcgttccccggggaatatatacccacagtctttgacaactac
tctgccaatgtgatggttgatgggaaaccagtgaatctgggtctatgggatacagcagga
caggaagactacgacagactccgaccactgtcctatccacagacggatgtgttcttgatt
tgcttctccctcgtgagtcctgcctcctttgaaaacgtccgtgccaagtggtacccagag
gtgagacaccactgccccaacacccccatcatcctggtgggcaccaagctggatctgaga
gatgacaaggataccatcgagaagctgaaggagaagaaactcacccccatcacctacccc
cagggcctggccatggccaaagagattggagcagtaaagtacctggaatgctcagccttg
acacagcgtggccttaagacagtatttgacgaagccatccgggcggtcctgtgtccccca
cctgtcaagaagaggaagaggaagtgctcactactctaa

DBGET integrated database retrieval system