KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224582
Entry
112224582         CDS       T05605                                 

Gene name
prkce
Definition
(RefSeq) LOW QUALITY PROTEIN: protein kinase C epsilon type
  KO
K18050  novel protein kinase C epsilon type [EC:2.7.11.13]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04530  Tight junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112224582 (prkce)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112224582 (prkce)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112224582 (prkce)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112224582 (prkce)
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     112224582 (prkce)
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   112224582 (prkce)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C ABC1 Kdo Kinase-like Calc_CGRP_IAPP RIO1 APH Zf_RING
Other DBs
NCBI-GeneID: 112224582
NCBI-ProteinID: XP_024243982
LinkDB
Position
25
AA seq 747 aa
MVVFNGLLKIKICEALDLKPTAWSLRHAVGPKTQTFLLDTYIALNVDDSRVGQTSTKQKT
NSPAWNDEFVTEVHDGRKIELSVFHDAPIGYDDFVANCIIQFEDILQNGSKHYEEWIDLE
PEGRVYVIMDLSGSSSEAPGSSENAEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYL
RQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGMKKDKEDTTPEEVGS
QRFSVNMPHKFGIHNFKVLTFCDHCGSLLWGLLRQGLQCKVCKVNVHRRCEXNVAPNCGX
DARGIAKVLSDLGVTPDKSPACPRRKKITQEPQQPLPCTPQTEEDRSKSAPTSPCDQDLK
ELENIRKALSFEQRGQEHKSASSSSSSRVGVGSEVGEARENGELKIIQTKRMTLQDFLFI
KVLGKGSFGKVMRAELKGTDEVVAVKVLKKDVILQDDDVDCTLTEKRILALARKHXYLTQ
LFCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEARSRFYAAEVTSALMFLHQHGVIYR
DLKLDNILLDANGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWW
ALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKSPNKRLG
CVITQGLEEAIKVHPFFKEIDWVLLEQKRVKPPFKPRIKTKRDVNNFDQDFTREEPVLTP
VEDAIIKQINQDEFKGFSYFGGEETLS
NT seq 2244 nt   +upstreamnt  +downstreamnt
atggtggttttcaatgggttattgaagatcaagatttgtgaggcgttggacttgaaaccg
acggcttggtctctcaggcatgcggttggcccaaaaacccagacttttctcctagacacc
tacatcgcactaaacgtggatgactcgcgtgtgggccaaacctccaccaaacagaaaacc
aacagccctgcgtggaacgacgagttcgttacggaggtgcatgacggaaggaaaatcgaa
ctgtcggtgtttcacgacgcgccaattggatatgacgatttcgtggctaactgcatcata
cagtttgaagatatattgcagaatggcagtaagcactacgaggaatggattgacttggag
cctgaggggagggtgtacgtcatcatggacctgtctggatcgtctagtgaagctccaggc
tccagtgagaatgcagaggagcgtgtgtttcgggagcgcatgcggccaaggaagaggcag
ggtgctgtacgaaggagggtccatcaggtcaacggacacaagttcatggccacataccta
cgacagcctacctactgctcccactgcagagactttatatggggtgtgatcgggaaacag
ggctaccagtgtcaagtgtgcacgtgtgtagtccataagcgatgccacgagctcatcatc
acaaagtgtgctgggatgaagaaagacaaggaggacactacaccagaggaggttggatcc
cagcggttcagtgttaatatgcctcataagtttggtattcacaacttcaaagtcctaacc
ttctgtgaccactgtggatcactattgtggggcctgctcagacaagggctgcaatgcaaa
gtctgtaaggtgaatgtacacagacgctgtgaangtaacgtggcccctaactgtgggngg
gacgcgaggggcatcgccaaggttctgtctgacctgggggtcacaccagacaaatctcca
gcatgcccaaggaggaaaaagataacccaagaaccccagcagccgttaccatgtaccccc
cagacagaggaggaccgatccaaatcggcccccacctccccatgtgaccaagatctgaaa
gagttggagaacatccgcaaggcgctgtcgtttgagcaacgtggacaggaacacaagtca
gcctcgtcctcctcttccagcagggtgggggtgggctcagaggtgggcgaggcccgagag
aacggagaactcaagatcatccagaccaagaggatgaccctgcaggacttcctcttcatc
aaggtcctgggcaaaggcagcttcggaaaggtgatgcgggctgagctgaaagggacagat
gaggttgtagctgtgaaggtgctgaagaaagacgtgatcctgcaggatgatgatgtggac
tgtaccctgacagagaaacgcatcctggccctggctaggaaacacncctacctgacccag
ctcttctgctgcttccagaccaaggaccgtctgttctttgtgatggagtacgtgaacgga
ggagaccttatgttccagatccagcgttccaggaagtttgacgaggcgcgctctcgcttc
tatgccgccgaggtcacgtctgccctcatgttccttcaccaacatggagtaatctacaga
gatctgaaattggataacatcctattggatgcaaatggccactgtaagctggctgacttt
ggcatgtgtaaggaggggatcctcaacggagtcaccaccaccaccttctgcgggacccct
gactacatcgctcctgagatcctacaggagctagaatatggcccctctgtggactggtgg
gctctgggggtgcttatgtacgagatgatggcgggccagcccccctttgaggctgacaat
gaggatgacctgtttgagtccattctccacgatgatgtcctctacccagtgtggctaagc
aaggaggcagtctccatcctgaaagcgttcatgacgaagagtccaaacaagcgtctgggc
tgtgtgatcacccagggtttggaggaggccatcaaggttcatcccttcttcaaggagatc
gactgggttctgctggagcagaagagggtcaaaccacccttcaaacctcgcattaaaacc
aaaagggacgtgaacaactttgaccaggacttcactcgcgaggagcctgtcctcacccct
gtagaagacgccattattaagcagattaaccaagatgagttcaagggtttctcctacttt
ggaggggaggagactctgtcctaa

DBGET integrated database retrieval system