KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225427
Entry
112225427         CDS       T05605                                 

Definition
(RefSeq) glycogen synthase kinase-3 beta-like isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04110  Cell cycle
otw04150  mTOR signaling pathway
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112225427
   04310 Wnt signaling pathway
    112225427
   04340 Hedgehog signaling pathway
    112225427
   04150 mTOR signaling pathway
    112225427
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112225427
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112225427
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112225427
   04916 Melanogenesis
    112225427
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112225427
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112225427
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     112225427
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   112225427
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112225427
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo Choline_kinase
Other DBs
NCBI-GeneID: 112225427
NCBI-ProteinID: XP_024245159
LinkDB
Position
26
AA seq 429 aa
MSGRPRTTSFAESCKPVPQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELLAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
DKVPLPKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPMVYVKLYMYQLFRSLAYIHSFG
ICHRDIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTS
SIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQI
KAHAWTKVSQQVFRPRTPPEAIALCSRLLEYTPTSRFTPLEACAHSFFDELRDPNVKLPN
GREKPSLFNFTTHELSSNPSLANILIPAHARTQAAASTPSNANANATTDGNSTDRSPNTI
TASASASTS
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgtctggtcggcccagaaccacctccttcgcagagagctgcaaaccagtgccgcagccc
tcggcttttggctctatgaaagtcagcagggacaaggatggcagtaaggtgacgacggtg
gtggccaccccaggccaagggcccgacaggccccaagaggtcagctatacagacaccaag
gtgattgggaatggctccttcggagtggtctaccaggccaagctgtgtgactctggagaa
ctgctggcgatcaagaaggttctgcaggacaagcggtttaagaaccgcgagctgcagatc
atgaggaagctggaccactgcaacatcgttcgcctgcgctacttcttctactccagcgga
gacaaggtccctctgcctaaggatgaggtgtatctgaacctggtactggactatgttcct
gagacggtctacagagtggccagacactacagccgagccaaacagaccctgcccatggtc
tatgtcaagttatatatgtaccagttgttcaggagtctggcctacatccactcgtttggg
atctgccatcgggacatcaaaccccagaacctgctgctggaccccgagacggccgtgctc
aaactctgtgacttcggcagcgctaagcagctggtacgcggagagcccaacgtgtcctac
atctgctctcgttactacagagcccccgagctcatctttggtgccaccgactacacctct
agcatagatgtgtggtcagctggttgtgtgctagcagagctgttgctagggcaaccaatc
ttccctggcgacagtggagtggatcagctggtggagatcatcaaggttctggggaccccg
acacgggagcagatccgagagatgaaccccaactacactgagttcaaattcccccagatt
aaggcacacgcatggactaaggtgagtcaacaggtgttccggccccgtaccccaccggag
gccatcgccctgtgttctcggctgctggagtacacgcccacctcgcgcttcacccccctg
gaggcgtgtgcacactccttcttcgacgagctgagggaccccaacgtcaagctgcccaac
gggcgagaaaaaccctccctcttcaacttcaccacgcatgagctgtccagtaatccctcg
ctggccaacatcctaatccccgcccacgcccgcactcaggccgccgcctccaccccatcc
aacgccaacgccaacgccaccacagatggtaacagcacagatcgcagccctaacaccatt
actgcctcggcctccgcctccacctcctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112241148
Entry
112241148         CDS       T05605                                 

Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04110  Cell cycle
otw04150  mTOR signaling pathway
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112241148
   04310 Wnt signaling pathway
    112241148
   04340 Hedgehog signaling pathway
    112241148
   04150 mTOR signaling pathway
    112241148
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112241148
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112241148
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112241148
   04916 Melanogenesis
    112241148
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112241148
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112241148
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     112241148
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   112241148
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112241148
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo Choline_kinase
Other DBs
NCBI-GeneID: 112241148
NCBI-ProteinID: XP_024265082
LinkDB
Position
3
AA seq 425 aa
MSGRPRTTSFAESCKTVPQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELIAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
DKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPIVYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVSQQVFRPRTPPEAIALCSRLLEYTPTSRLTPLEACAHSFFDELRDPNVKLPNGREK
PSLFNFTTQELSSNPSLANILIPAHARSQVTTSTPTNATVTTDGNSTDRGPSTTTASASA
SNSTS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgggtcggcccagaaccacctcctttgcggagagctgcaagacagtgccgcagccc
tcagcatttggcagtatgaaagtcagcagagacaaagatggcagtaaggtgaccacagtg
gtagcgaccccaggccagggccccgaccggccgcaggaggtcagctatacagacactaag
gtcatcggcaacggctcgttcggcgtggtctaccaggctaaactgtgtgactccggggag
ctaatagccatcaagaaggttctgcaggacaagaggtttaagaaccgcgagctgcagatc
atgaggaagctggaccactgcaacatcgttcgcctgcgctacttcttctactccagcgga
gacaagaaggatgaggtgtatctaaacctggttctggactatgttcctgagacagtctac
agagttgccagacactacagccgagccaaacagactctgcccatagtctatgtcaagtta
tatatgtaccagttgttcaggagtctggcctacatccactcgtttgggatctgccatcgg
gacatcaaaccccagaacctgctgctggaccccgagacggctgtgctcaaactctgtgac
ttcggcagtgctaagcagctggtgcgtggagagcccaacgtgtcctatatctgctctcgc
tactacagagcccccgagctcatctttggtgccaccgactacacctccagcatagatgtg
tggtcagctggatgtgtgctagcagagctgttgctagggcaaccaatcttccctggcgac
agtggagtggatcagctggtggagatcatcaaggttctggggaccccgacacgggagcag
atccgagagatgaaccccaactacactgagttcaaattcccccagattaaggcacaccca
tggactaaggtgagtcaacaggtgttccggccgcgcacgcccccggaggccattgccctg
tgctctcggctgctggagtacacgcccacctcgcgcctcactcccctggaggcgtgtgca
cactccttcttcgacgagctgagggaccccaatgtcaagctgcctaacgggcgagaaaaa
ccctctctcttcaacttcaccacccaggagctgtccagtaatccctcgctggccaacatc
ctaatccccgcccacgcccgctctcaggtcaccacctccaccccaaccaacgccaccgtc
accacagatggtaacagcacagatcgtggccccagcaccactaccgcctcagcctctgcc
tccaactccacctcctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112253937
Entry
112253937         CDS       T05605                                 

Definition
(RefSeq) glycogen synthase kinase-3 beta-like isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04110  Cell cycle
otw04150  mTOR signaling pathway
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112253937
   04310 Wnt signaling pathway
    112253937
   04340 Hedgehog signaling pathway
    112253937
   04150 mTOR signaling pathway
    112253937
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112253937
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112253937
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112253937
   04916 Melanogenesis
    112253937
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112253937
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112253937
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     112253937
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   112253937
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112253937
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo APH Choline_kinase
Other DBs
NCBI-GeneID: 112253937
NCBI-ProteinID: XP_024281833
LinkDB
Position
7
AA seq 427 aa
MSGRPRTTSFAESCKTVPQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELIAIKKVLQDKRFKNRELQIMRKLDHSNIVRLRYFFYSSG
DKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPMVYVKMYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVSQQPCVIGSQVFRPRTPPEAIALCSRLLEYTPTARFTPLEACAHTFFDELRDPNLK
LPNGREKPLLFNFSTQELSSNPSLASILIPAHARNQPGAFTPTNASAPSDANSGDRGHTT
NAAAAST
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgtcgggtcggcccagaaccacctcctttgcggagagctgcaagacagtgccgcagccc
tcagcatttggcagtatgaaagtcagcagagacaaagatggcagtaaggtgaccacagtg
gtagcgaccccaggccagggccccgaccggccgcaggaggtcagctatacagacactaag
gtcatcggcaacggctcgttcggcgtggtctaccaggctaaactgtgtgactccggggag
ctaatagccatcaagaaggttctgcaggacaagaggttcaagaaccgggagctgcagatc
atgaggaaactggaccacagcaacatagtgcgtttgcgctacttcttctattccagtgga
gacaagaaggacgaggtgtatctcaacctggttctggactacgttcctgagactgtgtac
agagtggctagacactacagccgagccaagcagaccctccccatggtctatgtgaagatg
tacatgtatcagctcttccggagcttggcctacatccattcctttgggatctgccatcgg
gacatcaagccccagaacctgctgttggacccggagacagccgtgctcaagctctgtgac
tttggcagtgcgaagcagctggtccgtggtgagcccaatgtgtcctacatctgctcacgg
tactacagagcccccgagctcatttttggggccactgactacacctccagcatagatgta
tggtccgctggctgcgttctagcagaactgttgctagggcaacccatttttcccggcgac
agtggggtggatcagctagtggagatcatcaaggttctcggcactcccactcgggagcag
atcagagagatgaatcccaactacactgagtttaagttccctcagatcaaggcacaccca
tggactaaggtgagtcaacagccttgtgtgattggctctcaggtgttccggccgcgcacg
ccccctgaggccatcgctctgtgctcgcggctgctggagtacacgcccacagcgcgcttc
acgcccctggaggcctgtgcccacacctttttcgacgagctccgggaccccaacctcaag
ctgcccaacgggcgcgagaagcccctgctcttcaacttctccacacaggagttgtccagt
aacccctccctagcctccatcctcatccccgcccacgcccggaatcagcccggggccttc
acccctaccaacgcctccgcaccctcagatgccaacagcggagaccgtggccataccacc
aacgctgccgccgcctccacctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112253980
Entry
112253980         CDS       T05605                                 

Definition
(RefSeq) glycogen synthase kinase-3 beta-like isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04110  Cell cycle
otw04150  mTOR signaling pathway
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112253980
   04310 Wnt signaling pathway
    112253980
   04340 Hedgehog signaling pathway
    112253980
   04150 mTOR signaling pathway
    112253980
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112253980
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112253980
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112253980
   04916 Melanogenesis
    112253980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112253980
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112253980
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     112253980
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   112253980
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112253980
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo Choline_kinase
Other DBs
NCBI-GeneID: 112253980
NCBI-ProteinID: XP_024281917
LinkDB
Position
7
AA seq 430 aa
MSGRPRTTSFAESCKAVPQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELIAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
DKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPMVYVKMYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVSQQPCVIGSQVFRPRTPPEAIALCSRLLEYTPTARFTPLEACAHTFFDELRDPNLK
LPNGREKPLLFNFSTQELSSNPSLASILIPAHARNQPGAFTPTNASAPSDANSGDRGHTT
NAASASNAST
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgtcgggtcggcccagaaccacctccttcgcagagagctgcaaagcggtgccgcagcct
tcagcatttggcagtatgaaagtcagcagagacaaagatggcagtaaggtgaccacggtg
gtagcgaccccaggccagggccccgaccggccgcaggaggtcagctatacagacactaag
gtcatcggcaacggctcgttcggcgtggtctaccaggctaaactgtgtgactccggggag
ctaatagccatcaagaaggttctgcaggacaagaggttcaagaaccgggagctgcagatc
atgaggaaactggaccactgcaacatagtgcgtttacgctacttcttctattccagtgga
gacaagaaggacgaggtgtatctcaacctggttctggactacgttcctgagactgtgtac
agagttgctagacactacagccgagccaagcagaccctccccatggtctatgtgaagatg
tacatgtaccagctcttccggagcttggcctacatccattcctttgggatctgccatcgg
gacatcaagccccagaacctgctgctggacccggagacagccgtgctcaagctctgtgac
tttggcagtgcgaagcagctggtccgtggtgagcccaatgtgtcctacatctgctcacgg
tactacagagccccagagctcatctttggggccactgactacacctccagcatagatgta
tggtccgctggctgcgttctagcagaactgttgctagggcaacccatttttcccggtgac
agtggggtggatcagctggtggagatcatcaaggttctcggcactcccactcgggagcag
atccgagagatgaatcccaactacactgagtttaagttccctcagatcaaggcacaccca
tggactaaggtgagtcaacagccttgtgtgattggctctcaggtgttccggccgcgcacg
ccccctgaggccatcgctctgtgctcgcgtctgctggagtacacccccacagcgcgcttc
acgcccctggaggcctgtgcccacacctttttcgacgagctccgggaccccaacctcaag
ctgcccaacgggcgcgagaagcccctgctcttcaacttctccacacaggagttgtccagt
aacccctccttagcctccatcctcatccccgcccacgcccggaatcagcccggggccttc
actcctaccaacgcctccgcaccctcagatgccaacagcggagaccgtggccataccacc
aacgctgcctccgcctccaacgcctccacctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112266570
Entry
112266570         CDS       T05605                                 

Definition
(RefSeq) glycogen synthase kinase-3 beta-like isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04110  Cell cycle
otw04150  mTOR signaling pathway
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112266570
   04310 Wnt signaling pathway
    112266570
   04340 Hedgehog signaling pathway
    112266570
   04150 mTOR signaling pathway
    112266570
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112266570
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112266570
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112266570
   04916 Melanogenesis
    112266570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112266570
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112266570
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     112266570
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   112266570
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112266570
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo APH Choline_kinase
Other DBs
NCBI-GeneID: 112266570
NCBI-ProteinID: XP_024299921
LinkDB
Position
14
AA seq 427 aa
MSGRPRTTSFAESCKTVPQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELIAIKKVLQDKRFKNRELQIMRKLDHSNIVRLRYFFYSSG
DKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPMVYVKMYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVSQQPCVIGSQVFRPRTPPEAIALCSRLLEYTPTARFTPLEACAHTFFDELRDPNLK
LPNGREKPLLFNFSTQELSSNPSLASILIPAHARNQPGAFTPTNASAPSDANSGDRGHTT
NAAAAST
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgtcgggtcggcccagaaccacctcctttgcggagagctgcaagacagtgccgcagccc
tcagcatttggcagtatgaaagtcagcagagacaaagatggcagtaaggtgaccacagtg
gtagcgaccccaggccagggccccgaccggccgcaggaggtcagctatacagacactaag
gtcatcggcaacggctcgttcggcgtggtctaccaggctaaactgtgtgactccggggag
ctaatagccatcaagaaggttctgcaggacaagaggttcaagaaccgggagctgcagatc
atgaggaaactggaccacagcaacatagtgcgtttgcgctacttcttctattccagtgga
gacaagaaggacgaggtgtatctcaacctggttctggactacgttcctgagactgtgtac
agagtggctagacactacagccgagccaagcagaccctccccatggtctatgtgaagatg
tacatgtatcagctcttccggagcttggcctacatccattcctttgggatctgccatcgg
gacatcaagccccagaacctgctgttggacccggagacagccgtgctcaagctctgtgac
tttggcagtgcgaagcagctggtccgtggtgagcccaatgtgtcctacatctgctcacgg
tactacagagcccccgagctcatttttggggccactgactacacctccagcatagatgta
tggtccgctggctgcgttctagcagaactgttgctagggcaacccatttttcccggcgac
agtggggtggatcagctagtggagatcatcaaggttctcggcactcccactcgggagcag
atcagagagatgaatcccaactacactgagtttaagttccctcagatcaaggcacaccca
tggactaaggtgagtcaacagccttgtgtgattggctctcaggtgttccggccgcgcacg
ccccctgaggccatcgctctgtgctcgcggctgctggagtacacgcccacagcgcgcttc
acgcccctggaggcctgtgcccacacctttttcgacgagctccgggaccccaacctcaag
ctgcccaacgggcgcgagaagcccctgctcttcaacttctccacacaggagttgtccagt
aacccctccctagcctccatcctcatccccgcccacgcccggaatcagcccggggccttc
acccctaccaacgcctccgcaccctcagatgccaacagcggagaccgtggccataccacc
aacgctgccgccgcctccacctga

DBGET integrated database retrieval system