KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225989
Entry
112225989         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: signal transducer and activator of transcription 3-like
  KO
K04692  signal transducer and activator of transcription 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04217  Necroptosis
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112225989
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    112225989
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112225989
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112225989
Transcription factors [BR:otw03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    112225989
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 Syntaxin-6_N FapA AP1AR
Other DBs
NCBI-GeneID: 112225989
NCBI-ProteinID: XP_024245928
LinkDB
Position
27
AA seq 789 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQTAT
TAAQDGTASHPSGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDMNGNSQAAATRQKMSQLEQMLSALDQLRRQIVTEMAGLLSAMDXVQKNLTDDE
LAXWKRRQQIACIGGPPNICLDRLETWSITSLAESQLQIRQQIKKRRSXQQKVSYKGDPI
IQHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPEL
NYQLKIKVIIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRC
GNGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASIL
WYNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVN
YSGCQITWAKFCKENMVGKGFSFWVWLDNIIDLVKKYILALWNEGYILGFISKERERAIL
SPKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYK
IMDATNILVSPLVYLFPEIPKEDAFGKYCRPEAAPEAELGDPCSTIQPYLKTKFICVTPC
PSVFMDFPDSELLGNGIFPGTNSGNTSDLFPMSPRTLDSLMHNEAEANPGPLDSLTLDME
LSSDVASPM
NT seq 2370 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttgcagcagctggagaccaggtacctggagcagctgtaccac
ctgtacagcgacagcttccccatggagctccggcagttcctcgccccctggatcgaaagc
caggactgggcgtacgcagcgaacaaggagtcccacgccacgctggtgttccacaacctg
ctgggggagattgaccagcagtacagccgcttcctgcaggagaacaacgtgctctaccag
cacaacctgcggcgcattaagcagcacctgcagtccaagtacctggagaaacccatggag
atcgcccgcattgtagcccgctgcctctgggaagagcagaggctgctgcagaccgccacc
accgccgcacaggacggaacggcgtctcacccgtctggcactgtggtgacggagaaacaa
cagatcctggagcacaacctgcaggacatcaggaagagggtgcaggatatggaacaaaag
atgaagatgcttgagaatctccaggatgattttgacttcaactacaagacccttaaaagt
cagggtgagttgtcccaggacatgaatgggaacagccaggcggcagccacccggcagaag
atgtctcagctggaacagatgctgagtgctctggaccagctcaggaggcaaatcgtgact
gagatggcagggctgctgtcagccatggatnntgtacagaagaacctgacagatgacgag
ctggctngctggaagaggaggcagcagattgcctgcatcggaggaccacccaacatttgc
ctggaccgcttggagacatggtcaattacttccctggctgagtctcagctgcagatccgc
cagcagatcaagaagcggaggagcnntcagcagaaggtgtcctataagggagaccccatc
atccagcaccggcccgctctggaggagaagatagtggacttgttcaggaacctcatgaag
agtgcgttcgtggtggagaggcagccttgtatgcccatgcatccagacagaccactggtc
atcaagacaggtgtgcagttcaccaacaaagtcagattactggtgaagtttccagaattg
aattaccagctgaagatcaaagttattattgacaaggaatctggggacgtggcagccatt
cgagggtcccgaaagttcaacatcctaggtaccaacaccaaggtgatgaacatggaggag
tccaacaatggcagtctgtcagcagagttcaaacacctgaccctgagggaacagaggtgt
ggcaatggtggcaggaccaacagtgatgcctccctgatcgttacagaggagctccacctc
atcacctttgagacagaggtctaccaccagggcttgaagatcgacctggagacccattct
ctaccagtggtggtcatctccaacatctgccagatgcccaacgcctgggcctccatcctg
tggtacaacatgctgaccaaccaccccaagaatgtgaacttcttcactaagcctccggtg
gggacgtgggatcaggtagcggaggtgctgagctggcagttctcctccaccactaagaga
ggcctgaccatcgagcagctcaccaccctggctgagaaactactagggccgtgtgtgaac
tactctggatgccagatcacctgggccaagttctgcaaagagaacatggtggggaaaggc
ttctctttctgggtatggctggacaacatcattgacctggtcaagaagtacatcctggct
ttgtggaatgaagggtatattctgggtttcatcagtaaggagagggagagggccatcctg
agccctaagcctcctggtaccttcctgctgcgcttcagtgagagcagtaaggagggaggc
atcaccttcacctgggtggagaaggacatcagtgggaagactcagatccagtcggtggag
ccttacaccaagcagcagctcaacagcatgtcctttgcggagatcattatgggatacaag
atcatggacgccaccaacatcctggtgtctccgctggtctacctcttcccagagatcccc
aaggaggacgccttcgggaagtactgccgaccggaagctgctccagaggcggagctcggc
gacccgtgtagtaccattcaaccatacttaaagacaaagttcatctgtgtaaccccgtgc
ccttccgtgttcatggactttccggacagcgagctgcttgggaacgggatattccctggc
accaactctggtaacaccagtgatctgtttcccatgtcccctcgcaccctggactctctg
atgcacaacgaggctgaggccaaccctggcccgctggactccctcactctggacatggag
ttgagctctgacgtggcgtcacccatgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258660
Entry
112258660         CDS       T05605                                 

Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04217  Necroptosis
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112258660
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    112258660
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112258660
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112258660
Transcription factors [BR:otw03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    112258660
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 PRKCSH-like
Other DBs
NCBI-GeneID: 112258660
NCBI-ProteinID: XP_024288941
LinkDB
Position
9
AA seq 807 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQSAT
TAAQDGTASHPSGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGDNPPNSSPICSELSQDMNGNSQAAATRQKMSQLEQMLSALDQLRRQIVTEMAGLLSAM
DFVQKNLTDDELADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQ
QKVSYKGDPIIQHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNK
VRLLVKFPELNYQLKIKVIIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEF
KHLTLREQRCGNGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNIC
QMPNAWASILWYNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTL
AEKLLGPCVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYILGF
ISKERERAILSPKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSM
SFAEIIMGYKIMDATNILVSPLVYLFPEIPKEDAFGKYCRPEAAPEAELGDPCSTIQPYL
KTKFICVTPCPSVFMDFPDSELLGNGIFPGTNSGNTSDLFPMSPRTLDSLMHNEAEANPG
PLALLLSVFPDSLTLDMELSSDVASPM
NT seq 2424 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttgcagcagctggagaccaggtacctggagcagctgtaccac
ctatacagcgacagcttccccatggagctccggcagttcctcgccccctggatcgaaagc
caggactgggcgtacgcagcgaacaaggagtcccacgccacactggtgttccacaacctg
ctgggggagattgaccagcagtacagccgcttcctgcaggagaacaacgtgctctaccag
cacaacctgcggcgcattaagcagcacctgcagtccaagtacctggagaaacccatggag
atcgcccgcatcgtagcccgctgcctctgggaagagcagaggctgctgcagtccgccacc
accgccgcacaggacggaacggcgtctcacccgtctggcactgtggtgacagagaaacaa
cagatcctggagcacaacctgcaggacatcaggaagagggtgcaggatatggaacaaaag
atgaagatgcttgagaatctccaggatgattttgacttcaactacaagacccttaaaagt
cagggtgataacccacccaactcctctcctatttgctcagagttgtcccaggacatgaat
gggaacagccaggcggcagccacccggcagaagatgtctcagctggaacagatgctgagt
gctctggaccagctcaggaggcaaattgtgactgagatggcagggctgctgtcagccatg
gactttgtccagaagaacctgacagatgacgagctggctgactggaagaggaggcagcag
attgcctgcatcggaggaccacccaacatttgcctggaccgcttggagacatggattact
tccctggctgagtctcagctgcagatccgccagcagatcaagaagctggaggagctccag
caaaaggtgtcctataagggagaccccatcatccagcaccggcccgctctggaggagaag
atagtggacttgttcaggaacctcatgaagagtgcgttcgtggtggagaggcagccttgt
atgcccatgcatccagacagaccactggtcatcaagacaggtgtgcagttcaccaacaaa
gtcagattactggtgaagtttccagaattgaattaccagctgaagatcaaagttattatt
gataaggaatctggggacgtggctgccattcgagggtcccgaaagttcaacatcctaggt
accaacaccaaggtgatgaacatggaggagtccaacaacggcagtctgtcagcagagttc
aaacacctgaccctgagggaacagaggtgtggcaatggtggcaggaccaacagtgatgcc
tccctgattgttacagaggagctccacctcatcacctttgagacagaggtctaccaccag
ggcttgaagatcgacctggagacccattctctaccagtggtggtcatctccaacatctgc
cagatgcccaacgcctgggcctccatcctgtggtacaacatgctcaccaaccaccccaag
aatgtgaacttcttcactaagcctccggtggggacgtgggatcaggtagcggaggtgctg
agctggcagttctcctccaccactaagagaggcctgaccatcgagcagctcaccaccctg
gctgagaaactactagggccgtgtgtgaactactctggatgccagatcacctgggccaag
ttctgcaaagagaacatggcgggtaaaggcttctctttctgggtatggctggacaacatc
attgacctggtcaagaagtacatcctggccttgtggaatgaagggtatattctgggtttc
atcagtaaggagagggagagggccatcctgagccctaagcctcctggtaccttcctgctg
cgcttcagtgagagcagtaaggagggaggcatcaccttcacctgggtggagaaggacatc
agtgggaagactcagatccagtcggtggagccttacaccaagcagcagctcaacagcatg
tcctttgcggagatcattatgggatacaagatcatggacgccaccaacatcctggtgtct
ccgctggtctacctcttcccagagatccccaaggaggacgccttcgggaagtactgccga
ccggaagctgctccagaggcggagctcggagacccgtgtagtaccattcaaccatactta
aagacaaagttcatctgtgtaaccccgtgcccttccgtgttcatggactttccggacagc
gagctgcttgggaacgggatattccctggcactaactctggtaacaccagtgacctgttt
cccatgtcccctcgcaccctggactcgttgatgcacaatgaggctgaggccaaccctggc
ccgctggccctcttgctttctgtcttcccagattccctcactctggacatggagttgagc
tctgacgtagcgtcacccatgtga

DBGET integrated database retrieval system