KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226021Help
Entry
112226021         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like isoform X1
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04210  Apoptosis
otw04625  C-type lectin receptor signaling pathway
otw04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112226021
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112226021
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112226021
   04672 Intestinal immune network for IgA production
    112226021
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     112226021
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  Other
   112226021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH DLEU7
Motif
Other DBs
NCBI-GeneID: 112226021
NCBI-ProteinID: XP_024245975
LinkDB All DBs
Position
27
AA seq 874 aa AA seqDB search
MAVRQRIFNSTRPFSGSPQIELKGSYPSLPSPEDRTSDEEGKESKGDFMPCLKPRIIKVL
TKGTAEQVGEAGPLNYQKNSFIAQAECETQDSQQFSPSCSERSFVASPNCLINRDSSEHN
NVACSSAASNQDQPGSPAHRSPRKKPRKKQKRKEKKEEQRETGKQRQRRRVPSGVPEQET
QTGSSPQLIQTQQDASEHQSNISTSYSSSIPSLEAHDTRRPPYPLQDCNRGPSHSHLYWG
PQVFSPPSNLSTYGQESDSDSPLSSVGDCSLALAGLRGSVSQEDRCYAGPFCKDFCKDVE
RDVREKEGEVSETDTNEGLIFNKNIQPVNYEYREGKDYSLCKSINTGSYGEVHSVQDNRT
HFRFGAKKILLKSFSSEEVGTWSALKSPRVVELFGVIREGPYVVLFMDLKAGSVGQLIKE
SGRLPEDLALHYHCQVLEALEHLLKRRVLHLDIKADNVLLSEDGRDTFLCDFGQSERMDI
CGQSLSASQGDLKGTETHMAPEIVKGETCRGAKADVWSSCCMLLHMLNGCQPWTRYYSRP
LYFKIANEPPPLREIPPDCSPFTADVIKVGLQKEPTKRASASELKGRAARALREVGGLSS
PIRGSYKEPLQIDDSPSQSSQPWPPFSRDTCSEESPELWLESMNPGSRELNNDEEEEGSE
ADTEETASPRSLLTQLHEWQNPKMADITSNVSELELRKLEREFYLTSLSQLHSAETQEQL
LSCLSSSDCYSNRDLWDRKDSGRWSISPGDDLSSGVFSYNSQPDGQILSMDWLVHQSHLS
PPRCFEGVDVCITGVNGQSIRIREKRRVKVGHIATGISDQISERVFTMETQEREPVAHDE
EVQDSGLLLRCVPAPDYCQAWRWRVKEGVLETRD
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgaggcaaaggatctttaactcgaccagaccgttctcagggtcaccccaaata
gagctgaaggggtcttacccaagcctccccagcccagaagacaggacgagtgacgaggag
gggaaggagagcaaaggggacttcatgccttgtttaaaacccagaataattaaagtccta
acgaagggcacagcagaacaagtgggtgaagcaggtccactgaactatcagaagaactcg
ttcatagcccaggctgaatgtgaaacccaagactcccagcagttcagcccttcctgctcc
gaacgctcctttgttgcatcccccaactgcttaatcaaccgggactcatcagagcacaac
aatgtggcgtgttcctccgcagcctccaaccaggaccaaccaggctccccggcccaccgc
tcacccaggaagaagccaaggaagaaacagaagaggaaggagaagaaagaggagcagagg
gagacagggaagcagagacagagacgtagagtaccttctggtgtccctgagcaggagacc
cagactggcagttctcctcaactgatccagacccagcaggacgcttcagagcaccaaagt
aacatcagcacttcatacagtagcagtatcccgagtttagaggcgcatgacacaagacgc
cccccttaccccctccaggactgcaacaggggccccagccattcccacctctactggggc
ccccaggtgtttagccccccctccaacctctccacctatgggcaggagagtgactcagac
tctcctctcagcagtgtgggagactgttcgttagccctagcagggctcaggggcagtgtc
agtcaggaggaccgatgctacgcaggtcccttctgcaaagacttctgcaaagatgtggaa
agagatgtcagggagaaggagggagaagtctcagagactgacaccaacgagggcctgatc
ttcaataagaatattcagcctgtgaattatgagtacagggaggggaaggactacagcctc
tgcaagtctatcaacacagggtcatacggggaagtgcacagtgtgcaagacaacagaaca
cacttcagatttggcgccaaaaagattctcctgaagagttttagtagtgaggaagtgggt
acgtggagtgccctgaagtctcctcgcgtggtggaactcttcggagtgatcagagagggg
ccctacgtcgtcctcttcatggacctcaaagctggctctgtgggtcagcttattaaagag
agtggtcggctacctgaggacctggccctgcactaccactgtcaggtccttgaggcgctg
gaacacctgctgaagagacgagtgctgcatctggacataaaggcggacaatgtgttgctg
tcagaggatgggagggacacttttctgtgtgactttggacaatctgagagaatggacatc
tgtggacagagcctaagtgcatcccaaggagatctgaaggggacagagacacacatggcc
ccggagattgtgaaaggggaaacctgccgcggagccaaagcagacgtgtggagcagctgc
tgcatgttactgcacatgctcaatggctgccagccctggacacgatactactcccgccca
ctgtacttcaagatagccaatgaaccaccgcctctgagggagatcccgcccgattgcagt
cccttcactgctgatgtcataaaggtggggctccagaaggagcccaccaagagggcctcc
gcctcggagctcaagggaagagcagccagagctctgagagaagtgggaggactcagcagc
cccattagagggtcctataaggagcccctacagatagatgacagccccagccagtctagc
cagccctggccaccctttagcagagacacctgctctgaggagagccctgagctatggctg
gaatccatgaacccagggagcagggagctgaacaatgatgaggaggaggaaggcagtgag
gcagacacagaggagacagcctcacctcgctctctactgacacaactccatgaatggcaa
aatcccaagatggccgacatcacctccaacgtatcggagcttgaactgcgcaagctggag
agagagttctacctgaccagtctgtctcagctgcactcagcagaaacccaggagcagcta
ctgtcctgcctgagcagcagtgactgttactccaacagggacttatgggacagaaaggac
tctggccgttggtccatcagcccaggtgacgacctcagctccggtgtgttctcctacaac
agccaaccagacggacagattctcagtatggactggctggttcaccaaagccacctgtct
ccaccccgatgctttgagggagttgacgtctgcatcacgggcgtaaatgggcaaagcatc
cggatacgagagaaacgcagggtgaaggtgggccacattgccacggggatcagcgaccag
atctctgagagggtgttcaccatggagactcaggagcgggagccagtggcccatgatgag
gaggtgcaggactctggcctcctgctccgctgtgtccctgctcctgactactgccaggcc
tggagatggagggtcaaggagggggtgctggagactcgtgactga

DBGET integrated database retrieval system