KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226218Help
Entry
112226218         CDS       T05605                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04540  Gap junction
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112226218
   04310 Wnt signaling pathway
    112226218
   04340 Hedgehog signaling pathway
    112226218
   04371 Apelin signaling pathway
    112226218
   04020 Calcium signaling pathway
    112226218
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112226218
  09143 Cell growth and death
   04114 Oocyte meiosis
    112226218
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112226218
   04540 Gap junction
    112226218
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112226218
   04912 GnRH signaling pathway
    112226218
   04914 Progesterone-mediated oocyte maturation
    112226218
   04916 Melanogenesis
    112226218
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112226218
   04270 Vascular smooth muscle contraction
    112226218
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112226218
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:otw03019]
    112226218
   03036 Chromosome and associated proteins [BR:otw03036]
    112226218
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     112226218
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  PKA family
   112226218
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     112226218
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112226218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 112226218
NCBI-ProteinID: XP_024246350
LinkDB All DBs
Position
27
AA seq 393 aa AA seqDB search
MLWARTVGKTFSEVQRQRHNVFVIYGQTVSAGKHADPFSLHRLFTKHVTASNVITLKLKE
FLAKAKEDFLKKWENPAQNTAALDGFDRLKTLGTGSFGRVMLVKHKESGQHFAMKILDKQ
KVVKLKQIEHTLNEKRILQAVSFPFLVRLEHSFKDNTNLYMVMEYVPGGEMFSHLRRIGR
FSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDNQGYIQVTDFGFAKRVKGRTWT
LCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRF
PSHFSSDLKDLLRNLLQVDLTKRFGNLRNGVNDIKGHKWFATTDWIAIYQRKVEAPFIPK
CKGPGDTSNFDDYEEEEIRVSFTEKCGKEFAEF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgggcccgaacagtcgggaaaaccttctccgaagtccaaagacaacgtcacaat
gtcttcgtcatatatggacaaactgtttcggctgggaagcatgcagacccctttagtcta
caccgtttgtttacgaagcatgtgacagcatcaaatgttataacgctcaaattgaaggag
tttcttgccaaagccaaagaggatttcctcaagaaatgggagaatccagcacagaacacc
gcagccttggatggctttgaccgtctgaagaccctgggcacgggctcgtttggtcgagtc
atgctggtcaagcacaaagagtcgggccagcattttgccatgaagatacttgacaaacag
aaggtggtgaagctgaagcagatagaacacacgctgaatgagaaacgcatcctgcaggcc
gtcagcttccccttcctggtgcggttggagcactctttcaaggacaacactaacctgtat
atggtgatggagtacgtccctggcggtgagatgttctcacatctaaggagaattggcagg
ttcagtgagccccacgcccgcttctacgccgcccaaattgttctgacctttgaatacctt
cactcactggacctcatctaccgagatctgaaaccagagaacctgctcattgacaaccag
ggatacatacaggtaacagattttggttttgcaaagcgcgtgaagggccggacctggacg
ctgtgtggcactccggagtacctggcccctgaaatcatccttagcaaaggttataataag
gcggtggactggtgggctctgggcgtgctgatttatgagatggctgctggctatcctccc
ttctttgctgaccagcccattcaaatctatgagaagattgtatcagggaaggtgcgcttt
ccctcccacttcagctcagacctgaaggacctgctgaggaacctgctccaggtggacctg
accaagcgcttcggcaacctgcgcaacggagtcaacgacatcaagggacacaagtggttc
gccaccactgactggattgccatttaccagaggaaggtggaggcaccgtttattcccaag
tgcaaaggccccggtgacaccagcaactttgacgactaygaggaagaggaaatccgagtc
tccttcacagagaaatgtggcaaggagtttgccgagttctag

DBGET integrated database retrieval system