KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226589
Entry
112226589         CDS       T05605                                 

Definition
(RefSeq) Krueppel-like factor 2
  KO
K17845  krueppel-like factor 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112226589
   04068 FoxO signaling pathway
    112226589
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112226589
Transcription factors [BR:otw03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    112226589
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-H2C2_5
Other DBs
NCBI-GeneID: 112226589
NCBI-ProteinID: XP_024246785
LinkDB
Position
28
AA seq 411 aa
MSFSGVILPSISTFANQTKSCEHKWKSEMDKPISSSCSILDMVQNMDCRSIGRKDDGDLC
NYLDLDFILANTTGSDSMTTAALGAGLEEYYMSSTDHPGNLFTTENPMPSYPSSEHRSPP
PPYSTSLMAELLRYEGENSYLVGITRNTSSIQGRLYVNSTPFPRQDILDNIKVEPSMDGY
GPVMGMVPQRCPKIKQEGNVLCMMSFEQPRVAISPRAARNMTPPLSPNDQGSSECPQQDP
MCHSMRFPHNYHSSAAYAHHHPGAPQATQMQIGPYQGAHQFGVYEEGLSMQPNTQRVLLT
PPSSPLELLETKPKRGRRTWPRKRTATHTCTFAGCGKTYTKSSHLKAHHRTHTGEKPYNC
GWEGCGWKFARSDELSRHFRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgtctttttccggggtgattttgccatccatctcgacatttgcaaaccaaaccaaaagt
tgtgaacataagtggaaaagcgagatggacaaacccatttcttccagctgctccattctt
gatatggtacagaacatggactgtcgcagtatcgggagaaaggacgacggggatctttgt
aattacttagatctggattttattctggccaacaccactggctcagacagcatgactact
gctgcgctgggagcaggtttagaggagtattacatgtcctcgacggatcatccaggtaac
ctgttcaccactgagaaccccatgccatcctacccctccagtgagcacagatccccgcct
ccaccctacagcaccagcctgatggcggagcttctcaggtacgaaggggagaacagctac
ctggtcggtattacgcgcaacacctccagcatccaaggaaggttgtatgtgaactctacg
ccgtttcccagacaggacattttagataacatcaaagtggaaccttccatggacggttat
ggacctgttatgggcatggttccccagaggtgtccgaaaatcaagcaagagggcaacgtg
ttgtgcatgatgtccttcgagcagccgagagtagccatctccccgcgggcagccagaaac
atgacgccaccgctcagccccaacgatcaggggagctccgagtgcccccagcaggacccg
atgtgtcactccatgagattcccacataactaccactcctcagcggcgtacgcacaccac
caccccggggcgcctcaagccacccaaatgcagattggaccataccaaggtgctcaccag
ttcggagtgtacgaggagggactcagcatgcaaccaaacacacagagggtactgctgacg
cccccatcttctccgctggagctgctagagaccaaaccaaagagaggtcgccgcacctgg
ccaaggaagcgcacggcgacgcacacctgcacattcgctgggtgcggaaagacttacacc
aagagctcgcatctgaaggcgcatcacagaacgcacactggtgaaaagccatacaattgc
ggctgggaaggctgcggctggaaattcgctcgctccgacgaactgagccgccatttccgc
aaacacaccggtcaccggcccttccagtgccacctgtgtgatcgcgccttctcccggtcc
gaccacctcgcgcttcacatgaagagacatatgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239790
Entry
112239790         CDS       T05605                                 

Definition
(RefSeq) Krueppel-like factor 2
  KO
K17845  krueppel-like factor 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112239790
   04068 FoxO signaling pathway
    112239790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112239790
Transcription factors [BR:otw03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    112239790
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-H2C2_5
Other DBs
NCBI-GeneID: 112239790
NCBI-ProteinID: XP_024263965
LinkDB
Position
Unknown
AA seq 412 aa
MALSGVILPPISTFANQTKSLENRWKSDMDKPMSSNCSMLDMVQNMDCRSIERKDDEDLS
SYLDLDFILANTTGSDSMPTAALGAGVALYNMPSVDYPGNPFTTGNPMPSYPSSEHSSPP
PPYSTSLMAELLRFEGENDYGVDTTRNTYSVQGRFYVNSALFPIRQDIIDNIKVEPSMDG
YGPVMSMGPQSCPKIKQEGNVSCMMSFEQPRVAVSPRAASNMTPPLSPNDQGSSECRQQV
PMGHSMSFPQNYHSSATYTHQRPGAPPAAQMQLGTYQGAHQFGMYEEGLSMHPNTQRVLL
TPPSSPLELLETKPKRGRRTWPRKRTATHTCTFAGCGKTYTKSSHLKAHHRTHTGEKPYH
CSWDGCGWKFARSDELTRHFRKHTGHRPFQCHLCERAFSRSDHLALHMKRHM
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggctttatccggtgtgattttgccacccatctcgacattcgcaaaccaaaccaaaagt
ttagaaaataggtggaaaagcgacatggacaaaccgatgtcttccaactgctccatgctt
gatatggtacagaacatggactgtcggagcatcgaaaggaaagacgacgaagatctgagt
agctacttagatttggatttcattctggcaaacaccactggatcagacagcatgcctacc
gctgcgctgggagcaggtgtagcgttgtataacatgccctcagtggattatccaggcaac
ccgttcaccaccgggaaccctatgccatcctacccgtccagcgagcatagctccccgcct
cccccctacagcaccagcctgatggcggagcttctcaggttcgagggagagaacgactac
ggagtcgatactacgcgtaatacctatagcgtccaaggacggttttatgtcaactcggca
ctttttcccattagacaggacattattgataacatcaaagtggagccgtccatggacggt
tatggacccgttatgagcatgggcccccagagttgtccaaaaatcaagcaagagggaaac
gtgtcgtgtatgatgtcctttgagcagccgagagtagccgtctctccgcgggcagccagc
aacatgacgccaccgctcagccccaacgaccaggggagctccgagtgccgccagcaggta
ccgatgggccactccatgagcttcccacagaactaccactcctcggcgacgtacacacac
caacgccccggagcgcctccagccgcacagatgcagcttggaacataccaaggcgctcac
cagttcggcatgtacgaggagggactgagcatgcatccgaacacacagagggtactgctg
acgcccccgtcctctccgctggaactgctggagaccaagcccaagagaggtcgccgcacc
tggccgcggaagcgcacggctacgcacacctgcacattcgctgggtgcggaaagacttac
accaagagttcacatctgaaggcacatcacagaacgcacactggtgaaaagccataccat
tgcagttgggacggttgcggctggaaattcgctcgctccgacgaactgacacggcatttc
cgcaaacacaccggtcaccggcctttccagtgccacctgtgcgagcgcgcattctcccgg
tccgaccaccttgcgcttcacatgaagcgacacatgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250790
Entry
112250790         CDS       T05605                                 

Definition
(RefSeq) Krueppel-like factor 2
  KO
K17845  krueppel-like factor 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112250790
   04068 FoxO signaling pathway
    112250790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112250790
Transcription factors [BR:otw03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    112250790
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-H2C2_5
Other DBs
NCBI-GeneID: 112250790
NCBI-ProteinID: XP_024276994
LinkDB
Position
5
AA seq 392 aa
MEMALTGTILPSIATFANQKEKCWENRWKGEMDRPVHSSCAVVESMDNCMGRKDEEELDK
FLDLEFILSNSTGTDSNTPSSGTEYRLGEQNNMYHSGMQSTYPLPEMSSPPPPYNSLMAE
LLRTELDSSFCHQLSGNSIHGRFLVSSSAFPNQDFVDNIKVEPSMDSYGPLMGMVPQSCP
KIKQEGNVSCMMSFEQPRLANSPQAAGNMTPPLSPDDLMSSECQPQMCHSMTFPQSYRSA
AGYPHSHPSQQMQLPYQSAHQFGMYEDGMGMQPTNQRVLLTPPSSPLEMMDSKPKRGRRS
WPRKRTASHTCTFAGCGKTYTKSSHLKAHHRTHTGEKPYHCSWEGCGWKFARSDELTRHF
RKHTGHRPFQCHLCERAFSRSDHLALHMKRHM
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggaaatggccttaaccgggaccattttaccatccatcgctacatttgcgaaccaaaag
gaaaaatgctgggaaaataggtggaagggagagatggacaggcctgtgcattccagctgt
gctgtggtggagagcatggacaactgcatgggcagaaaagacgaagaagagctcgataaa
ttcctggatctggagtttattctctctaactccacgggcacagacagcaacactccatcc
tccgggacggagtacaggctaggagagcagaacaacatgtatcactccgggatgcagtct
acctacccgctgcccgagatgagcagcccacctccaccttacaacagcctgatggctgag
ctcctgcgcactgagcttgacagcagcttctgccaccagctttccggcaacagcatccat
gggagatttctagtcagttcctctgccttcccaaatcaggactttgtagacaacatcaag
gtcgagccgtccatggacagttacggaccgcttatgggcatggtgccacagagctgccca
aagatcaagcaggaggggaacgtttcgtgcatgatgtccttcgagcagccgagactagcc
aactctccacaggctgcggggaacatgacaccacctctcagcccagacgacctgatgagc
tccgagtgtcagccccagatgtgccactccatgactttcccccagagctaccgctccgca
gcgggataccctcactctcacccgtcccaacagatgcagctcccgtaccagagcgcacac
cagttcgggatgtatgaagacggaatgggtatgcagcccaccaaccagagagtgctactc
actccaccgtcctccccgctggagatgatggactcaaagccaaagaggggtcggcgctcc
tggccaaggaagcgcacagcgtctcacacatgcactttcgctggatgcgggaaaacctac
accaagagctcgcacttgaaagcgcaccacagaacgcacaccggtgaaaaaccataccat
tgcagttgggagggttgtggctggaagttcgcccgctccgacgagctgacacgccatttc
cgcaagcacactggccacaggccgttccagtgccacctgtgtgagcgcgccttctccagg
tccgaccacctcgcgctgcacatgaagcgacacatgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252192
Entry
112252192         CDS       T05605                                 

Definition
(RefSeq) Krueppel-like factor 2
  KO
K17845  krueppel-like factor 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112252192
   04068 FoxO signaling pathway
    112252192
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112252192
Transcription factors [BR:otw03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    112252192
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-H2C2_5
Other DBs
NCBI-GeneID: 112252192
NCBI-ProteinID: XP_024278992
LinkDB
Position
6
AA seq 394 aa
MEMSLTGTILPSIATFANQKEKCWEYRWKGEMDRSVHSSCAVAEGMDICMGIKDEEELDK
FLDLEFILSNSTGTDSNTPSSGTEGEYRLVEQNNMYHSVMQSTYTVPEINIPPPPYNSLM
AELLRNELDSSFCHQPSGNSVHGRFLVSSSAFPNQDFPDNIKVEQSMDSYRPVMEMVPQS
CPKIKQEGNVSCMMSFEHPRLANSPQSAGNMTPPLSPDDLMSSECQTQMCHSLTFPQSYR
SAACYPHSHPTPQMQLSYQSAHQFGMYEDGMGIQHTNQRALLTPPSSPLEMMDSKPKRGR
RSWPRKRTASHTCTFAGCAKTYTKSSHLKAHHRTHTGEKPYHCSWEGCGWKFARSDELTR
HFRKHTGHRPFQCHLCERAFSRSDHLALHMKRHM
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggaaatgtccttaaccgggaccattttaccatccatcgccacatttgcgaaccaaaag
gaaaaatgctgggaatataggtggaagggcgagatggacaggtcggttcattccagctgt
gccgtggctgagggcatggacatctgcatgggcataaaagacgaagaggagctagataaa
ttcctggatctggagtttattctctctaactccactggcacagacagcaacactccatcc
tccgggacagagggagagtacaggctagtagagcagaacaacatgtatcactccgtgatg
cagtctacctacaccgtgcccgagataaacattccacctccgccgtacaacagcctgatg
gctgagctcctgcgcaatgagcttgacagcagcttctgccaccagccctctggcaacagc
gtccatgggagatttctagtcagttcgtctgctttcccaaatcaggactttccagacaac
attaaggtcgagcaatccatggacagttaccgaccagttatggaaatggtccctcagagc
tgcccaaaaatcaagcaggaggggaacgtttcgtgcatgatgtccttcgaacatccgaga
ctagccaactctccgcagtctgcggggaacatgacaccacctctcagcccagacgacctg
atgagctccgagtgtcagacccagatgtgccactccctgactttcccgcagagctaccgc
tccgctgcgtgctaccctcactctcacccgaccccacagatgcagctctcgtaccagagc
gcacaccagttcgggatgtacgaagacggaatgggtatacagcacaccaatcagagagcg
ctgctcactccaccgtcctctccgttggagatgatggactcaaagccaaaaaggggtcgg
cgttcctggccaaggaagcgcacagcgagtcacacttgcactttcgctggatgcgcgaaa
acctacaccaagagctcgcacttgaaagcgcaccacagaacgcacacaggagagaaacca
taccattgcagttgggagggttgtggctggaagttcgcccgctccgacgagctgacgcgc
catttccgtaagcacactggacacaggccgttccagtgccacctgtgcgagcgcgccttc
tccaggtccgaccacctcgcgctgcacatgaagcgacacatgtga

DBGET integrated database retrieval system