KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226590
Entry
112226590         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase STK11-like isoform X1
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04530  Tight junction
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112226590
   04150 mTOR signaling pathway
    112226590
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112226590
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112226590
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112226590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112226590
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112226590
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   112226590
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 112226590
NCBI-ProteinID: XP_024246786
LinkDB
Position
28
AA seq 362 aa
MSDGELQHLDYLTENELMGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGK
VKEMLDSDTLCRRAVKILKKKKLRRIPNGEANVKKFTLLVMHCQALSALNADWLTAMVYQ
TVYHGEIQLLRRLQHKNVIHLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVFQ
AHGYFLQLLDGLEYLHSQGIVHKDIKPGNLLLTTDGALKISDLGVAEALHPFAEDDTCRT
SQGSPAFQPPEIANGLDTFSGFKVDIWSAGITLYNITTSLYPFEGDNIYKLFENIGKGDY
SVPEECGPALSDLLQGMLEYDPVKRFSIQHIRQHNWYVKNTRQQNHRCRSLPARRAGTCG
AA
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgagtgacggggagctgcagcacctggactatctgactgagaatgagctgatgggcatg
gacacgttcattcaccgcatcgactcaaccgaggtgatataccagccacgcaggaagagg
gccaagctgattgggaagtacctgatgggagacctgctgggggagggctcctacggtaag
gtgaaggagatgctggactctgacacgctgtgtcgcagggccgtcaagatcctcaagaag
aagaagctgaggcggatccccaacggagaggctaatgtgaagaagtttacactcttggtc
atgcattgtcaagcactgtcagccctgaatgctgattggctaacagccatggtatatcag
accgtataccatggggagatccagctgctacggagactccagcacaaaaatgtgatccat
ttggtggatgtgttgtacaatgaagagaagcagaaaatgtatatggtgatggagtattgc
gtatgtgggatgcaagaaatgctggacagcgtcccagagaaaagatttccagtatttcaa
gctcacgggtactttttacagctgttagatggccttgaatatttgcacagccagggaatc
gttcacaaggacattaaaccaggaaatctgcttctgactaccgacggggcactcaagatc
tccgacctgggcgtggcagaggctctgcacccgtttgcagaggatgacacgtgtcgtacg
agtcagggctcgccggcgttccagccccccgagatcgccaatggcctggacaccttttca
gggttcaaagtggacatctggtccgcaggcatcacactatacaacattacaacgagtctt
tatccgtttgaaggggacaacatctataagctatttgagaacattgggaagggagactac
agtgttccagaagagtgcgggcctgccctgtcagacctactgcaaggaatgcttgaatat
gatcccgtcaagaggttttcaatacagcacatacggcaacacaactggtacgtaaaaaac
acccgccaacagaaccaccggtgccgatccctgccagcgcggagagctgggacgtgtggc
gcagcatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250849
Entry
112250849         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase STK11-like
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04530  Tight junction
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112250849
   04150 mTOR signaling pathway
    112250849
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112250849
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112250849
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112250849
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112250849
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112250849
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   112250849
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 112250849
NCBI-ProteinID: XP_024277103
LinkDB
Position
5
AA seq 455 aa
MNDEDIHEHMDYLENDLTMCMETFIHRIDSTEVIYEPRRKKAKLIGKYLMGDLLGEGSYG
KVKEMLDSETLCRRAVKILKKKKLRRIPNGEQNVKKEIQLLRRLRHKNIIQLVEVLYNEE
KQKMYMVMEYCVCGMQEMLDSVDEKRFPVFQAHGYFCQLLDGLEYLHSQGIVHKDIKPGN
LLLTTNGALRISDLGVAEALHPFAEDDTCCTSQGSPAFQPPEIANGLDTFSGFKVDIWSA
GVTLYNITTSLYPFEGDNIYKLFENIGKGDYSVPEECGPLLSGLLRGMLEYDPEKRFSIQ
NIRQHNWVRKKHPATEPLVPMPPSADRRDAWRSMTVLPYLEHLHGYADQDDEDDDELFYG
DGEIIYSQGFTMTGRVHEDGLEQNGHQGGCVGPGLGLGLRTLCVNGTETDQDHYPTTSRT
RSRSERLSSSSSSNPSRKGVSTYSRIRKLSNCKQQ
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaatgacgaggacatccatgaacacatggactatttggagaatgacttgaccatgtgc
atggaaaccttcatccaccgcatcgactccactgaagtcatctacgagccgcggaggaag
aaggccaagctgattgggaagtacctgatgggagacctgctgggggagggctcctacggg
aaggtgaaggagatgctggactctgagaccctctgcaggagggcagtcaagatcctcaag
aagaagaagctgagacgcatccccaatggggagcaaaatgtaaaaaaagagattcagctg
ctacgaagattaaggcacaagaatattatccagttggttgaagttttgtataatgaggag
aagcaaaagatgtatatggtgatggaatattgtgtatgtggaatgcaggagatgttggac
agtgttgatgagaaaaggtttccagtctttcaagctcatgggtacttttgccagctgcta
gatggcttggaatatttgcacagccaaggaatagttcacaaagatattaaaccagggaat
ctactgctgacgacgaatggcgcactaagaatctccgacctgggtgtagcagaggcgctg
cacccatttgcagaggacgacacgtgttgtacgagccagggctctccggccttccagccc
ccagagattgccaacggcctggacaccttctcagggttcaaagtggacatctggtctgct
ggtgtcacactttataacataacaaccagcctgtaccctttcgaaggtgacaacatctat
aagctgtttgagaacattgggaagggagactacagtgttccagaggagtgtggccctctg
ctctctggcctgttaagaggaatgcttgagtatgaccctgagaagaggttctcaatacaa
aacattagacaacacaactgggtaaggaagaaacaccctgcaacggagcctctggtgccc
atgccccctagtgctgatcggagggacgcgtggcgtagcatgaccgtactgccctacctg
gagcacctgcacggctacgccgaccaggacgacgaggatgacgacgaactcttctacgga
gacggagagatcatctactctcagggtttcactatgacaggtcgggtgcatgaggatggg
ctggagcagaacgggcaccaggggggttgtgtggggccggggctggggctggggctcagg
accctatgtgtgaacggcacggagacagaccaggatcactacccaaccaccagcaggacc
aggtcccgatcagagcgcctctcctcctcctcctcctccaacccctcacgcaaaggagtg
tccacctacagccgcatccgcaagctgtccaactgcaagcagcaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260836
Entry
112260836         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase STK11-like
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04530  Tight junction
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112260836
   04150 mTOR signaling pathway
    112260836
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112260836
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112260836
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112260836
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112260836
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112260836
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   112260836
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 112260836
NCBI-ProteinID: XP_024291965
LinkDB
Position
10
AA seq 433 aa
MSVGELQHLDYLTENELMGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGK
VKEMLDSDTLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLQNKNVIHLVDVLYNEEK
QKMYMVMEYCVCGMQEMLDSVPEKRFPVFQAHGYFLQLLDGLEYLHSQGIVHKDIKPGNL
LLTTDGTLKISDLGVAEALHPFAKDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAG
VTLYNITTSLYPFEGDNIYKLFENIGKGDYSVPEECGPSLSDLLQGMLEYDPVKRFSIQH
IRQHNWVRKKHPPTEPPVPIPASAESRDVWRSMTVVPYLEDLHGYTEEEDQEFYDQEDDI
IYTQDFTVPGQVPEEDLDEAEVDLSRAQAKPVCVNGTESKAKPERRSSSSSNPSRKGVST
ASKIRKFSTCKQQ
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgagtgtcggggagctgcagcacctggactatctgactgagaatgagctgatgggcatg
gacacgttcatccaccgcatcgactccacagaggtgatctaccagccgcgcaggaagagg
gccaagctgatcgggaagtacctgatgggagacctgttgggggagggctcctacggtaag
gtgaaggagatgctggactctgacacgctgtgtcgcagggccgtcaagatcctcaagaag
aagaagctcagaaggatccccaatggagaggccaacgtgaagaaggagatccagctgctc
cggagacttcagaacaaaaatgtgatccatttggtggacgtgttgtacaatgaagagaag
cagaaaatgtatatggtgatggagtattgcgtatgtgggatgcaagaaatgctggacagc
gtcccagagaaaagatttccagtatttcaagctcacgggtactttttacagctgttagat
ggtcttgaatatttgcacagccagggaatcgttcacaaagacattaaaccagggaatctg
ctgctgaccactgacggcacgctcaagatctcagacctgggtgtggcagaggctctgcac
ccgtttgcgaaggatgacacgtgccgtacaagtcagggctcgccagcgtttcagcccccc
gagatcgccaacggcctggacacgttttcagggttcaaagtggacatctggtccgcaggc
gtcacactatacaacattacaacgagtctatatccgtttgaaggggacaacatctataag
ctatttgagaacattgggaagggagactacagtgttcctgaggagtgtggcccctccctg
tcagacctattgcaaggaatgcttgaatatgatcccgtcaagaggttttccatacagcac
atcaggcaacacaactgggtacgtaaaaaacacccaccaacggagcccccggtgcccatc
ccagccagcgcagagagccgggacgtgtggcgcagcatgacggtggtgccctacctggaa
gacctgcacggctacaccgaggaagaggaccaggagttctatgaccaggaggatgacatc
atctacactcaggacttcactgtgccagggcaggtaccagaggaggatttggatgaggct
gaggtggatctgagccgggcccaggccaagcctgtgtgtgtaaacggaacggagagcaag
gccaagccagagcgcaggtcctcctcctcatccaatccctcccgcaaaggagtctccaca
gccagcaagatacgcaagttctccacctgcaaacagcaatga

DBGET integrated database retrieval system