KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226989Help
Entry
112226989         CDS       T05605                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type-like isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00010  Glycolysis / Gluconeogenesis
otw00030  Pentose phosphate pathway
otw00051  Fructose and mannose metabolism
otw00052  Galactose metabolism
otw01100  Metabolic pathways
otw01200  Carbon metabolism
otw01230  Biosynthesis of amino acids
otw03018  RNA degradation
Module
otw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112226989
   00030 Pentose phosphate pathway
    112226989
   00051 Fructose and mannose metabolism
    112226989
   00052 Galactose metabolism
    112226989
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    112226989
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112226989
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:otw03019]
    112226989
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     112226989
Protein phosphatases and associated proteins [BR:otw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112226989
Messenger RNA biogenesis [BR:otw03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     112226989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 112226989
NCBI-ProteinID: XP_024247517
LinkDB All DBs
Position
28
AA seq 783 aa AA seqDB search
MAKRQDTKKFFENLSGAGKSIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFVHEGYQG
MVDGGDNIEEASWESVSSMLQVGGTVIGSARCKEFRSHEGRLKAAHHLVQRDITNLCVIG
GDGSLTGANLFREEWSGLLEELVQQGLIDEKAAQNNSELHIVGMVGSIDNDFCGTDMTIG
TDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLKVKVALACGADWVLIPEMPPED
GWEEQMCQKLSENRADKKRLNIIIVAEGAIDSHNKPITTDHIKELVVSCLGFDTRVTILG
HVQRGGTPSAFDRILASRMGVEAVLALLEASASTPACVVSLCGNQAVRLPLMECVQMTQD
VQKAMDEKNFEEAVRLRGRSFENNLNTYKLLSYRKADSELPNSSFNVAVLNVGAPAAGMN
AAVRSAVRVGITEGHKMFAVNDGFEGFYKGQIKEIKWGDVGGWTGQGGSILGTKRTLPAK
HLDKIAEQIRIHNINALLVIGGFEAFECLLQLYEARTSHEDFCIPMCVLPATISNNVPGT
DLSIGADTSLNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLASVGGLAAGADAVYIY
EEPFDIRDLQSNVEHLTEKMKTGIQRGLVLRNENSNENFTTDFIYQLYSEEGKGVFDCRK
NVLGHMQQGGAPSPFDRNFGTKIAAKAIQWISRKLKESYKEGKVFANTEDTACLLGMRRR
AMVFQPVVQLKDQTDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVTRVRPK
KVD
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcggcaggacaccaagaaattctttgagaatctttccggtgctggaaaatcc
atcggcgttctgacaagcggaggagatgctcaaggtatgaatgctgctgtacgggctgtg
gtccgcatgggtatttatgtgggagctaaagtctacttcgtccatgagggttaccagggt
atggtagatggtggggataatattgaagaggcatcatgggaaagtgtctccagcatgctg
caagtgggtggcacagtcattggcagtgcccgctgcaaggagttccgcagccacgagggg
cgtctgaaggctgcccaccacctggtgcagcgtgacatcaccaacctgtgtgtgatcgga
ggggacggcagcctcactggggccaacctcttcagagaggagtggagcggactactggag
gaactggtccagcaggggctgattgatgagaaggctgcccagaacaattcagagctgcac
atcgtgggaatggtgggctccatcgacaacgacttctgtggcactgacatgacaatcggg
acagactctgccctgcacagaatcatagaggtggtggacgcaatcatgactacagcccag
agccaccagaggacgtttgtgctggaggtcatgggaagacattgtgggtacttaaaagtt
aaagttgctctggcctgcggggctgactgggtgctgatccctgagatgccccctgaggac
gggtgggaggaacagatgtgtcagaaactgtctgagaatcgtgcagataagaaacggctc
aatatcattattgtagcagagggggcgatagattctcacaacaagcctatcactacagac
catattaaggaattggttgttagctgtctgggctttgacacccgagtcaccatcctgggt
cacgtccagagaggaggaaccccctctgcctttgaccggatcctggccagtcgtatggga
gtggaggcggtcctggccctgttggaggcgtcagccagcacaccggcctgcgtagtgtct
ctgtgtgggaaccaggctgtccgtctgcccctcatggagtgtgttcagatgacacaagac
gtccagaaagccatggacgagaagaattttgaggaagctgtgagactgcgtggcaggagt
ttcgaaaacaacctgaacacctacaaactcctgtcttaccggaaagcagactctgaactc
ccaaatagctccttcaacgtggcggtgctgaacgtgggtgcccctgctgcgggcatgaac
gcagctgtccgctcggccgtcagggtgggcatcaccgaggggcacaagatgttcgccgtt
aacgatggcttcgagggattctacaagggacagataaaggagattaaatggggagatgta
ggtggttggactggacaaggggggtccatactgggaacaaagagaacccttccagcgaag
catcttgataagatagctgaacaaatcaggatacataacatcaatgctttgcttgttatc
ggtggatttgaggcgtttgagtgtctgctgcagctctatgaggcccggaccagccatgag
gacttttgcatcccgatgtgtgtgctgcctgccaccattagtaacaatgtgcctggtact
gatctgagtatcggggcagacacttccctcaatgccatcgtggagacatgtgaccgcatc
aagcagtctgccagtgggaccaagcggcgtgtgttcatcattgagaccatgggggggtac
tgtgggtacctggccagtgtcggggggctggctgcgggggctgacgctgtctacatctat
gaggaacctttcgacatcagagacctccagtccaacgtcgagcatttgacagagaagatg
aagacgggcatccagaggggcttggtgctgaggaatgagaactccaatgagaacttcacc
acagatttcatctaccagctgtactctgaggaggggaaaggagtgttcgactgcaggaag
aatgtccttggacatatgcagcagggaggtgctccttccccattcgacaggaactttgga
acgaagattgcagccaaagcgattcaatggatttcaagaaagctcaaggagtcatataaa
gaagggaaggtgtttgctaacacagaggacactgcctgtttgctggggatgcgtcgcaga
gccatggtcttccaaccagtggtgcagctcaaagaccaaacagactttgtccacaggatc
cctaaggaacagtggtggttgaagctccgccccctgatgaagatcctggctaaatacaag
accagctacgacgtgtctgactctggccagctggagcatgtgacccgggtcaggcccaag
aaggtggactga

DBGET integrated database retrieval system