KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226990Help
Entry
112226990         CDS       T05605                                 

Definition
(RefSeq) trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112226990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:otw01002]
    112226990
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112226990
Enzymes [BR:otw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     112226990
Peptidases [BR:otw01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   112226990
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112226990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin
Motif
Other DBs
NCBI-GeneID: 112226990
NCBI-ProteinID: XP_024247521
LinkDB All DBs
Position
3
AA seq 200 aa AA seqDB search
MGKPSMQQIQHVPQCRTLFLFLEVRLVEHNIKVPEDTEQHMSARFIRHPDYNSGTQDSDI
TLIKLSPPATLNSYVSLVALLTYCVNVRTMCQVSGWGSLRASNEGLRYHDTLQCVEVPLL
TDNTCLEACFFQMTENMICAGFMEGGKDSCQGHSGGPLVCDGELQGVVSWGHGCALRKKP
GVYTEVCNYVSWIQNTMTSG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaccaagcatgcagcaaatccaacacgttccccagtgcaggaccctctttctt
tttttggaggtccgtctggtggagcacaacataaaggtgcctgaggacacggagcagcac
atgtctgcccggttcatccgccacccagactacaactccggtacccaggatagtgacatc
acgctgataaagctaagcccgcctgccaccctcaacagctatgtgagccttgtggccctc
ctcacttattgtgtcaatgtcagaaccatgtgccaggtctctggctgggggagccttcgc
gccagcaacgaaggcttgagataccatgacacactgcagtgtgtggaggtccccctcctg
actgataacacctgcctggaagcctgtttcttccagatgactgagaacatgatctgtgct
ggcttcatggagggaggcaaggactcatgccagggtcactctggtggccctctggtgtgt
gatggggagctgcagggtgttgtgtcctggggtcatggctgtgctctcaggaagaagcct
ggcgtctacacagaagtctgcaactacgtgtcatggatccaaaacaccatgacatctggc
taa

DBGET integrated database retrieval system