KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227128
Entry
112227128         CDS       T05605                                 

Definition
(RefSeq) B-cell lymphoma 6 protein-like isoform X1
  KO
K15618  B-cell lymphoma 6 protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112227128
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112227128
Transcription factors [BR:otw03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    112227128
SSDB
Motif
Pfam: zf-H2C2_2 BTB zf-C2H2 zf-C2H2_4 zf-met DZR zf-C2H2_jaz zf-C2HE zf-C2H2_6 Zn-ribbon_8 DUF4765 zf-C2H2_11
Other DBs
NCBI-GeneID: 112227128
NCBI-ProteinID: XP_024247743
LinkDB
Position
28
AA seq 668 aa
MHEVSRKVLQDSDTMASLADGCIQFTRHAGDVLLNFNRLRSRNILTDVTIQIDGQHFCAH
KTVLVACSGLFYSIFTDPLKSNLSAISLDPEVDPDGFAILLDFMYTSTLTLKDSFVLVTM
NTASYLQMEHVVDTCRRFIKSREQSVSLQREEVLASPMHLSQDLPAFRVLDRVATSPSHT
SISPLRDWRSYCPSVFSGINASGSSHHVHGKHIPIRKMSDACNVSDIPKGGAIFQKLCST
LNRTETTIIHHPLSSDSSSSSVTTICPLPCSSRQTEPLGSLQGPEHRGASPMEEDRNKHP
QPSSLSLSPGCTKGVICSPQSPLRSDCQPNSPTESSGCSRNAVPALTQPSGCSQEPKARN
WKKYKFIVMNQTSGEKEDESHVGSVEAGDCSPPQGRYRTSGSEGSVEELQTGEMVNEHWE
EVLVSQASHRSVRQQRCSSCGTDAPQHLEVCSHSPGSYTGEDTNELHSEYSDSSGENGSY
FCNECDAKFAEADSLKGHMLQVHADKPYKCDRCQAAFRYKGNLASHKTVHTGEKPYRCNI
CGAQFNRPANLKTHTRIHSGEKPYKCETCGSCFVQVAHLRAHVLIHTGEKPYPCEICGTH
FRHLQTLKSHLRIHTGEKPYHCEKCDLHFRHKSQLRLHLRQKHGAVTNTKAQYRQANKDM
LIGLAKAC
NT seq 2007 nt   +upstreamnt  +downstreamnt
atgcacgaagtttccaggaaagttttacaagattctgacaccatggcctcattggcagat
ggctgcattcaattcacccgccatgccggtgatgttctgctcaacttcaaccgcctccgc
agcagaaatatcctgacggacgtcactatccagattgacggtcagcacttctgcgctcac
aagacggtcctcgtggcttgcagtggacttttttactccatattcacggaccccctgaag
agtaacctgagtgccatcagcttggaccctgaagttgaccctgatggttttgccatcctg
ctggacttcatgtacacctccaccctgaccctgaaggacagcttcgttctggttaccatg
aacacagcctcttacctccagatggaacatgtggtggacacctgtcgcaggttcatcaag
tccagagagcagtctgtgagtctgcagagagaggaggtactggccagcccgatgcatctc
tctcaggacctccctgctttcagggttctggatagggtggcgaccagccccagtcacaca
tccatatctcccctcagagactggaggagctactgccccagtgtattcagtggtatcaat
gcttcaggtagctcccaccacgtccacggaaaacacatccccatcagaaaaatgtcagat
gcctgcaatgtcagtgacattcccaaagggggcgccatctttcagaaactctgctctacc
ttgaatcgcacagagaccaccatcatacaccaccctttgtcatccgactcctcatcctcc
tcagttacgaccatctgccctctcccctgctccagccgtcagacggagccacttgggagc
ctccaggggcctgaacacagaggggcctcccccatggaggaggacaggaacaagcaccca
cagcccagctccctcagcctgtccccaggctgcaccaaaggggtgatctgcagtcctcag
agccctcttcgttctgactgccaacccaactcccccactgagtccagtggatgcagcagg
aacgcagtcccggccctgacccagccatccggctgctcccaggagcccaaggcccgcaac
tggaagaagtacaagtttatcgttatgaaccagacctctggggagaaggaggatgagtcc
catgtaggaagtgttgaggctggggactgctctccaccgcagggccgctacaggaccagt
ggatcagagggatccgttgaagaactccagactggagagatggtcaacgagcattgggaa
gaggtccttgtgtcacaggccagccatcgcagcgttaggcagcagagatgctcctcctgt
ggtacggatgcccctcagcacctggaggtgtgttcccactcccctgggtcctacacgggg
gaggacaccaatgagctgcactctgagtactccgactcaagcggtgagaatggttcctac
ttctgcaacgagtgcgacgcaaagtttgcggaagcggactccctgaaaggacacatgctc
caggtccatgctgataagccatacaagtgtgaccgatgccaggctgccttccgttacaaa
gggaaccttgccagccacaagactgtccacactggagagaaaccataccgctgtaacatc
tgcggcgctcagttcaaccggccggccaacctcaagacccacacccgcatccactcggga
gagaagccgtacaagtgtgaaacgtgtggctcttgcttcgtacaggtagctcacctccgg
gcccatgtgctgatccacacaggggagaagccttatccctgtgagatctgtggcacgcac
ttccgccaccttcagaccctcaagagccacttacggatccacacaggagaaaagccatac
cactgcgagaaatgtgaccttcactttcgccacaagagccagttgaggctgcatctccgt
cagaagcacggcgcggtcaccaacactaaggctcagtaccgccaggcgaacaaggacatg
ctcattggcttggccaaggcctgctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260186
Entry
112260186         CDS       T05605                                 

Definition
(RefSeq) B-cell lymphoma 6 protein-like
  KO
K15618  B-cell lymphoma 6 protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112260186
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112260186
Transcription factors [BR:otw03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    112260186
SSDB
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-met zf-C2HE zf-C2H2_jaz Zn-ribbon_8 zf-C2H2_6 zf-C2H2_2
Other DBs
NCBI-GeneID: 112260186
NCBI-ProteinID: XP_024290867
LinkDB
Position
10
AA seq 650 aa
MASLADGCIQFTRHAGDVLLNFNRLRSRNILMDVTIQIDGQRFCAHRAVLVACSGLFYSI
FTDPLKSNLSAISLDPTVDPDGFAILLDFMYTSTLTLKDSLVLVTMNTASYLQMEHVVDT
CRRFIKSREQSVTLQRDEVLTSPMRLSQDLPAFRALDGLATSPSHTSMSPLRDRRSYCPS
VFTGINASGSSHHVHGKHIPMPIGKLPDTLNFSDLHKGDSISQKFFSPANRTEATTIVHH
PLSSQSSSSSVTILRPLPCSSRPSGPFMGLQGPKHRGASPMEEDSIQPPQPDSLSLSPGC
SKGVICSPQSPLRSDCQPNSPTESSGCSRNATQPSGCSQEPKARNWKKYKFIVMNQTSRE
KDEDEAQGGSVEAGDCTTPQGSNRTSGSEGPMKELQAAEMVNVHGEEILVPQASHHNINQ
LRCSSCGTDAPQHLVVCPRSPGTYSGEDNELHSEYSDSSGENGCNFCNSKFTEADSLKGH
MLQVHAAKPYKCDRCQAAFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIH
SGEKPYKCETCGSRFIQVAHLRAHVLIHTGEKPYPCEICGTHFRHLQTLKSHLRIHTGEK
PYHCEKCDLHFRHKSQLRLHLRQKHGAVTNTKAQYRRANTDMLVGLAKAC
NT seq 1953 nt   +upstreamnt  +downstreamnt
atggcctcattggcagatggctgcattcaattcacccgccatgctggtgatgttctgctc
aacttcaaccgcctccgcagtagaaatatcctgatggatgtcacaatccagattgacggt
cagcgcttctgcgctcacagggcagtcctcgttgcctgcagtgggctcttttactccata
ttcaccgaccccctgaagagtaacctgagtgccatcagcctggaccccacggtggaccct
gatggttttgccatcctgctggacttcatgtacacctccaccctgaccctgaaggacagc
ctggttttggttaccatgaacacagcgtcatacctccagatggaacatgtggtggacacc
tgccgcaggttcatcaagtccagagagcagtctgtgactctgcagagagatgaggtactg
actagcccgatgcgtctctctcaggacctccctgctttcagggctctggatgggttggcg
accagccccagccacacatccatgtctcccctcagagaccggaggagctactgccccagt
gtattcactggtatcaatgcttcgggtagctcccaccacgtccacggaaaacacatccca
atgcccatcggaaagctgccagacaccctcaatttcagtgacctccacaaaggggattcc
atctctcagaagttcttctctcccgcgaatcgcacagaggccaccaccatcgtccaccac
cctctttcatcccagtcctcatcatcctccgttacaatcctccgccccctcccctgctcc
agccgcccgtcggggcccttcatggggctccagggacctaaacacagaggggcctccccc
atggaggaggacagcatccagcccccccagccagactccctcagcctgtccccaggctgc
agcaaaggtgtgatctgcagcccgcagagccccctccgctctgactgccagcccaactct
cccaccgagtccagcggctgcagcaggaatgcaacccagccctctggctgctcccaggag
cccaaggcccgcaactggaagaagtacaagttcatcgtgatgaaccagacctccagggag
aaggacgaggatgaggcccagggagggagcgttgaggctggggactgcaccactcctcag
ggctctaacaggactagtggatcagagggaccgatgaaggagctgcaggctgcagagatg
gtcaacgtgcacggagaagagatccttgtcccacaggccagccatcacaacattaaccaa
ctgagatgctcctcctgtggtacagatgcccctcagcacctggtggtgtgtccccgctcc
cctggcacctacagcggggaggacaatgagctgcactctgagtactccgactcaagcggt
gagaatggttgcaacttctgcaactcaaagtttacggaagcggactccctgaaaggccac
atgctccaggtccatgctgccaagccatacaagtgtgaccggtgccaggctgccttccgt
tacaaagggaacctcgccagccacaagactgtccacaccggcgagaaaccgtaccgctgt
aacatctgcggtgctcagttcaaccggccggccaacctcaagacccacacccgaatccac
tcaggagaaaagccatacaagtgtgaaacgtgtggctctcgcttcatacaggtcgcgcac
ctccgcgcccacgtgctgatacatacgggggagaagccatacccctgtgagatctgtggg
acacacttccgccatcttcagaccctcaagagccacttgcgcatccacacaggagaaaag
ccctaccattgcgagaaatgtgacctccactttcgccacaagagccagttgaggctgcat
ctccggcagaagcacggcgcggtcaccaacaccaaggctcagtaccgccgggcgaacacg
gacatgctcgttggcttggcaaaggcctgctaa

DBGET integrated database retrieval system