KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227395Help
Entry
112227395         CDS       T05605                                 

Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00010  Glycolysis / Gluconeogenesis
otw00053  Ascorbate and aldarate metabolism
otw00071  Fatty acid degradation
otw00280  Valine, leucine and isoleucine degradation
otw00310  Lysine degradation
otw00330  Arginine and proline metabolism
otw00340  Histidine metabolism
otw00380  Tryptophan metabolism
otw00410  beta-Alanine metabolism
otw00561  Glycerolipid metabolism
otw00620  Pyruvate metabolism
otw01100  Metabolic pathways
Module
otw_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112227395
   00053 Ascorbate and aldarate metabolism
    112227395
   00620 Pyruvate metabolism
    112227395
  09103 Lipid metabolism
   00071 Fatty acid degradation
    112227395
   00561 Glycerolipid metabolism
    112227395
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    112227395
   00310 Lysine degradation
    112227395
   00330 Arginine and proline metabolism
    112227395
   00340 Histidine metabolism
    112227395
   00380 Tryptophan metabolism
    112227395
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112227395
Enzymes [BR:otw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     112227395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 112227395
NCBI-ProteinID: XP_024248032
LinkDB All DBs
Position
3
AA seq 518 aa AA seqDB search
MLRIVLSRTLPRISRISNCQYSAAAIPVPCAQPEVHYNKLFINNEWQDAVSKRSFPTINP
ATGEVICQVAEADKADVDKAVKAAREAFRFGSPWRRMDASDRGLLLSRLADAIERDTAYL
AELETLDNGKPYAVSYSVDVPMVVKCLRYYAGWADKWEGKTIPIDGDFFCYTRHEPIGVC
GQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPPGVVNILP
GMGPSAGSAIASHMDVDKVAFTGSTEVGHLIQQASGSSNLKKVTLELGGKSPNIIMSDAN
MAEAVEQSHFALFFNQGQCCCAGSRTYVQDTIYDEFMERSVERAKSRVVGDPFNMKTEQG
PQVDEEQFKKILGYISSGKREGAKLMCGGGVAADRGYFIQPTIFGDVQDGMTIAREEIFG
PVMQILKFKTLEEVVERANDTKYGLAAAVFTKDIDKAHYISSGLRAGTVWINCYDVFGAQ
APFGGYKYSGNGRELGEYGLDNYTEVKTVTIKVPQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaattgtgttatcccgaactttgcctcgaatctctcgcatttcgaattgtcag
tattctgcagccgccatcccggtaccatgcgcccagcccgaagtccattacaacaagctg
ttcatcaataacgagtggcaggatgccgtcagcaagaggtccttccccaccatcaaccca
gccacaggagaggtcatctgtcaggtggctgaggcagacaaggcagatgtggacaaggct
gtgaaggctgccagggaggccttccggtttgggtcaccatggcgacgcatggacgcgtcg
gaccgcgggctgctcctgagccggctggcagacgcaatcgagagggacacagcctaccta
gcggaactggagaccctggacaatgggaagccctatgccgtatcctacagtgtggatgtg
cccatggtggtcaagtgcctcaggtactatgcaggctgggcagataagtgggaggggaag
accattcccattgatggagacttcttctgctatacccgccatgagcccatcggtgtgtgt
ggccagatcatcccgtggaacttccctctgctgatgcaggcatggaagctggggccagct
ctggctacaggcaacactgtggtgatgaaggtggctgagcagacccccctcactgccctg
tatgtggccagtctcatcaaggaggttggtttccctccaggtgtggtgaacatcctgcct
ggtatgggtccatctgctggttctgccatcgcctcccacatggatgtggataaggtggct
ttcacaggatctactgaggtaggtcacctgatccagcaggcatctggctccagcaacctg
aagaaggtcactctggagctgggaggaaagagccccaacataatcatgtctgatgccaac
atggcggaggcggtggaacagtcccactttgccctgttctttaaccagggccagtgctgc
tgtgccggctcccgtacatacgtgcaggacaccatctatgatgagtttatggagcgcagt
gtggagcgggccaagagcagggtggtgggagaccccttcaacatgaagactgagcagggg
ccgcaggtggatgaggaacagttcaagaagattctgggctacatcagcagtgggaagcgt
gagggggccaagttgatgtgcgggggaggggtggctgcagaccgtggctacttcatccaa
ccaaccatctttggagatgtccaggacggcatgaccatcgcccgtgaggagatctttggg
ccggtaatgcagatcctgaagtttaagactctggaggaggtggttgagagagccaacgac
acaaagtacggcctggcagctgctgtcttcaccaaagacatcgacaaggcccactacatc
tctagcggacttcgcgccggcactgtctggattaactgctatgatgtgtttggagcacaa
gcccccttcggtggctacaaatattctggtaacggtcgtgagctgggagagtatggcctg
gacaactacactgaagtgaaaacagtaacaatcaaggtccctcagaaaaactcgtaa

DBGET integrated database retrieval system