KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112228298
Entry
112228298         CDS       T05605                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112228298
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112228298
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112228298
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112228298
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112228298
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   112228298
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 112228298
NCBI-ProteinID: XP_024249263
LinkDB
Position
30
AA seq 244 aa
MDLVTLGCPWMIDGVQIQTESPRQPLHHMGQFSQETHFHRRPDTQKLRDSSNSHLGRSDR
ADMLAHLGHCNVVLSQPQGHLAGTSRPEGLYRMTEGEITVLSMGPTTQQNYRHLIRLYCM
NGGHHLQILQDGTVAGSRDENKDDILKVKAVSAGVVAIKGHETGRYLAMDKDGHLYGSKT
LKDECYFLEKMEENHYNTYRSQKYQAKDWFLGLKRNGQPKAGQRTHIGQKAIYFLPRPVD
NTTM
NT seq 735 nt   +upstreamnt  +downstreamnt
atggatctggtgacgctgggctgcccctggatgattgacggagtacaaatacagacagag
tcacccaggcagccactgcaccacatgggccagttctcccaggagacccacttccacagg
agacctgacacacagaagctgagagactcatccaattcacacttgggaagaagcgacagg
gcggacatgctggctcatctgggacattgtaacgtggtgttgtcacagccacaggggcat
ttagcaggcacatctcgtccagagggactctacagaatgacagagggagaaattactgtg
ctctccatggggccaacgacacagcaaaactacagacatctcatacggctctactgtatg
aacggaggacatcatctgcagatcctacaggatgggactgtcgcgggtagcagagatgaa
aataaagatgacatcctgaaggttaaagcagtgagtgctggtgtggtggccatcaagggc
catgagacgggccgttacctggccatggacaaagatggtcatctctatggatcgaaaact
ctgaaggatgagtgttacttcctggagaagatggaggagaaccattacaacacatacagg
tctcagaagtaccaggccaaagactggttcctggggctcaagaggaatgggcagcctaaa
gctggccaaaggacacacattggccagaaggccatatattttctgcctcggcctgttgac
aacaccaccatgtaa

DBGET integrated database retrieval system