KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112228679
Entry
112228679         CDS       T05605                                 

Definition
(RefSeq) rho GTPase-activating protein 35-like
  KO
K05732  glucocorticoid receptor DNA-binding factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112228679
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112228679
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112228679
Membrane trafficking [BR:otw04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    112228679
SSDB
Motif
Pfam: RhoGAP-FF1 Ras FF Cdh1_DBD_1 NOG1
Other DBs
NCBI-GeneID: 112228679
NCBI-ProteinID: XP_024249982
LinkDB
Position
30
AA seq 1310 aa
MIMMAKKQDVKSPTYNLIVVGLSGTEKEKGQCGVGKSCLCNRFVRPSADDFYLDHTSVLS
TSDFGGRVVNNDHFLFWGEVGRVVEEGPECRMHVVEQTEFIDDQTFQPHRSTAMQPYIKR
AASTKLASAEKLMYFCTDQLGLEQDFEQKQMPEGKLQADGFVLCMDVSRGMNRNFDDQLK
FVTNLYGHLSKTKKPIVLVLTKCDEGVERYIKDSHTFAITKKSLPVVETSARSNINVDLA
FLTLVQLIDKSRGKPKIIPYFEALKLQSQQIALAKDRYEWLVNRIVKNHNETWLNTSXRM
HXSSEFXEYVFLEGTAKCKKLFQQXVYRLKQEHIERRRKIYLSTLPLALSSLVPDLDEID
QLSWSGVQKVLESKQHFAHWFVVLEDSPWEDTSHIDNMEDERIPSDLLETLPAEDIFDAH
LEHLRNECKRAEMRQEFKHKLACSPFVTPGKPWEEARSFIMNEDFYQWLEESEYLDLYNR
HQKEIIGHAKEDFQELLLEYSELFYELEVDAKPSKEKMGAIQEVLGEEQRFKALQKLPAE
RDALVLKHIHFVYHPTKETCPSSPQCGDFRIEQLLASRFPTCYPFFNVKSYFGDIKADRI
NLVILGKDGLAREFANEIRALCTNDDRYVLDGKMYELTLRPIEGNVRLPVNSFHTPTFTP
HGCLCLYNSKESLTYVVESIERLRESTIGRRDSHIAQLLTSLLLVTKRGVGTYADIGGET
ALGLITQGQQVARRLQCSFLDPASPGVGYGHNVNESQINQVLRGLLDSRRSSSFSSSSPP
LPPQTPGPRDSPHQPSPEADIRIVMCLMCGDNYDVEQLLSPFLLPQHCRPTSNSGTSVIL
EQTVGPHKQVIELSLLSYHASFSLRKSRLVHGYIAVYSARRKASLETLCAFLCEVQDIIP
VQLLAVGESQVELTESESAREQLVQGEELAQEIEGRFNSVVCGSGGVVGGLHRMEMFHPF
LMEVVEKRNIVEATHMYDNVAEACINETAYSPRCSSPSTGTMFLDSDMDDVEPSPPYYDG
TLTSHGGSLNLPDLDSSDVSVISDISSFENKLNSKATPQVRPKPSVTFDFRKVGRNPYNT
DTMGHRRSLPSAVTWVPGGDGGYDPSDYAEPMDAVSKPRPSNEEIIYSVPHDSTQGKIIT
IRNANRMHANGNGSDSEADSSSLERRRKFSAAGVKPRLYRDRSKRLGKFSSFRTSFIGSE
DEMGALPKTKEDDFGTLKGDIINEEGEDPKKRNILKSLRRTAKKTRPKPRSSIPKPLESS
YFGVPLVNVVSPDRPIPLFIDKCVRFIETTGGSLFSFSSSPLCLFKCIFV
NT seq 3933 nt   +upstreamnt  +downstreamnt
atgataatgatggccaaaaagcaagatgttaagtcacccacatacaaccttattgtggtg
ggtttgtcaggaactgagaaagagaagggccagtgtggcgtgggtaagtcctgtctgtgc
aaccgctttgtgcgccccagtgccgatgacttctatctggaccacacgtcagtgctgagc
accagtgactttgggggtagagtggttaacaatgaccatttcctgttctggggggaggtg
gggcgggtggtggaggaggggccggagtgcaggatgcatgtggtggagcagacagagttc
attgatgaccagacgttccagccacaccgcagcactgccatgcagccctacatcaagagg
gcggcctccaccaagctggcctctgcagagaagcttatgtacttctgcacggaccagctg
gggctggagcaggactttgagcagaagcagatgcccgagggcaagttacaggctgacggg
ttcgtgctctgtatggacgtcagtagggggatgaaccgcaactttgacgaccagttgaag
tttgtcacaaacctttacggtcatctgagcaaaacaaagaagcccattgtgctggtctta
accaagtgtgatgagggggttgaacgctacatcaaagattctcacacctttgccatcact
aaaaagagtcttccagtagtggagacatctgcacgctctaacatcaatgttgacctagcc
ttccttactttggtgcaactcattgataagagcaggggcaagcccaagatcattccttac
tttgaggccctcaagcttcagagtcagcagatagccttggctaaagaccgatacgaatgg
ctagtcaaccgcatagtgaagaaccacaatgagacctggcttaacaccagckgacgcatg
cacasctcrtcagagttcaamgaatacgtctttctygagggracagcyaaatgcaagaag
ctcttccagcagcwmgtmtaccgrctgaaacaggagcacattgagagacgtcggaaaatc
tatctgagcactcttcctctagcacttagctccctggtgcctgacctggatgagatcgac
cagctgagctggtctggggttcagaaggtcctggagtccaagcagcactttgcccactgg
tttgtagttctggaggactctccatgggaggacacgtctcacatagacaacatggaggat
gagcgcatcccctcagacctgctggaaacgttaccagccgaggacattttcgacgcccac
ctggagcacctgaggaatgagtgcaagcgggctgagatgaggcaggagttcaagcacaag
ttggcctgttctccctttgtcacgcctggcaagccctgggaagaggcccgcagcttcatc
atgaatgaagacttctaccaatggttggaggaatcagagtacctggacctctacaaccgc
caccagaaagagatcatcggccacgctaaagaggacttccaggagcttctgctggagtat
tccgagctcttctatgagctggaggtggacgcaaagcccagcaaggagaagatgggggcc
atccaggaggttttaggggaggagcagcggttcaaagccctgcagaagcttccagctgag
agagatgctctggtattgaagcatattcactttgtctaccaccccaccaaggagacctgt
cccagcagcccacagtgtggagacttcaggatagagcagctcctggcctcacgcttccca
acatgctacccattcttcaacgtgaagtcttattttggggatattaaagcggaccgcatc
aaccttgtgatattgggcaaagacggactggctagggagtttgccaatgagatcagagct
ctctgtaccaatgacgaccggtatgtgttggatgggaagatgtatgagctcaccctgcga
cctatcgagggcaatgtacgacttcctgttaactccttccacactcccaccttcacaccc
catgggtgcctgtgtctgtacaactcaaaagagtccctaacctacgtcgtagaaagcatt
gaaaggttgcgggagtcaacaatcggtagaagggacagccatatagctcagcttttaaca
tctctgctcttggttactaaaaggggtgtagggacctatgccgatattgggggagaaact
gctttaggtctgataacacagggacagcaggtagcaaggagattgcagtgtagcttcctc
gacccagcttcacctggtgtgggctatgggcacaatgtgaatgagagtcagatcaaccaa
gtattgagaggtcttctggactctagaaggagctcatctttcagtagcagctccccacct
ctgccccctcaaactccaggtcccagagactctcctcaccagcccagcccagaggcagac
atccgcatcgtcatgtgcttgatgtgtggagacaactatgacgtggaacagctcctctct
cccttcctactgcctcagcactgcaggccaacatccaacagtggcacctcggtgatactg
gagcagacagtgggacctcacaaacaggtgattgagctctctctcctttcctaccacgcc
tccttctccctgaggaagagcagattagtgcatggctacatcgctgtgtactcagcccgc
cgcaaggcttctctggagaccctgtgtgccttcctatgtgaggtccaggacatcattcct
gttcagctgctggctgtgggggagagccaggtggagctcacagaaagtgagtctgccaga
gagcagctggtccagggagaggagctggcccaagagatagagggcaggttcaacagtgtg
gtgtgtggatcaggaggggtggtgggtggcctgcacaggatggagatgtttcatcccttc
ctgatggaggtggtggagaaacgcaacatcgtggaggccactcacatgtatgataacgtg
gctgaggcctgcattaacgagactgcctactcccctcgctgtagctcacccagcactggc
actatgttcctagactctgacatggatgacgtggagccctccccaccttactacgacggc
acactcacctcccatggtgggagcctcaacctgcctgacctggactccagcgatgtctct
gtcatctctgacatcagctcctttgagaacaagctcaatagcaaagccacgccccaggtg
agacccaagccctctgtgacctttgacttccggaaggtgggcagaaacccctacaacaca
gacaccatgggtcaccgtcgctccctgccctccgctgtgacatgggtgccaggtggggac
ggaggttacgacccctcggactatgcagagcccatggatgctgtgtccaagccccggccc
agcaacgaggagatcatctactctgtgccccatgacagcacgcagggcaagattattacc
atccgcaatgccaatcggatgcacgccaacgggaacggctcagacagtgaggcggacagc
agttccctggagcgccgcaggaagttctcggcggcaggggtaaagccacggctctaccgc
gaccgctctaaacgcctgggcaagttcagcagcttccgcaccagcttcattggcagcgaa
gacgagatgggggctctgccaaaaaccaaggaggatgatttcggaaccctgaaaggagac
atcatcaatgaggagggagaggaccccaagaagaggaacattctgaagagcctgcggcga
actgccaagaaaaccagaccaaagcctcggtcctctattcccaagcccctggagagcagc
tacttcggggtgcccctggtcaacgtggtgtccccagacagacctatcccactcttcatt
gacaagtgtgtccgctttattgagaccacaggtgggtcactattttctttctcctcttct
cccctgtgtttgttcaagtgtatatttgtctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112244951
Entry
112244951         CDS       T05605                                 

Gene name
arhgap5
Definition
(RefSeq) rho GTPase-activating protein 5
  KO
K13709  Rho GTPase-activating protein 5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112244951 (arhgap5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112244951 (arhgap5)
Membrane trafficking [BR:otw04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    112244951 (arhgap5)
SSDB
Motif
Pfam: RhoGAP RhoGAP-FF1 FF Ras NOG1 GTP_EFTU Roc MMR_HSR1 Cdh1_DBD_1
Other DBs
NCBI-GeneID: 112244951
NCBI-ProteinID: XP_024268620
LinkDB
Position
Unknown
AA seq 1502 aa
MAKNKEARPLTYAVSVVGLSGTEKEKGNCGVGKSCLCNRYVRSNADSYYTEHTSVLSTID
FGGRVVNNDHFLYWGEVPHRSDDGLECKIQIIEQTEFIDDQTFLPHRSTNLQPYTKRAAA
SKIQSAEKLMYICTDQLGLEQDFDQKQMADGKLNVDGFILCIDVSKGCNRKFEDQMKFVN
SLYSQMVKSKKPIVIAATKCDECVEQYLRDLQAFAASKKNLLVVETSARSSINVDLCFNA
LTQQMDKTRGKPKTIPYLEAYKVQRQLVATVSDKFEKRIVQTVRDYHTSWKMVSNTLKNH
PDYEEYINLEGTRKARNTLNKHIEQLKQEHIRKRREEYFLSLPKILNNLLNNLEELENLS
WSEAQSILKSRAEFQFWFVVLEHTPWDETDQIDKVNDRRVPFDLLKTSEGEKIYQNHVQH
LFSEKRRLEMKDRFKKTLDRVHFISPGQPWEEVMCFVMEDEAYKYISESDRRDVYSQHQQ
EIVERAKEEFQEMLFEHAELFYDLDLNATPSCDKMSEIHTVLNEEPRYRALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQSCVDMNVEQVLANRLVQLDHSRSNLYYNSANIEKVNLCL
LGREGLAQELANEIRAQSTDDEYTLDGKIYELELLPVDVNSTLLFSHTWASTFKPHGIFC
VFSSIESLNCIGDCIGRIRAEIAQNRRERYAQPLPFILILANQRDSVCKNMPILRHQGQQ
LANKLQCTFVDIPSDTFPRKFNELQIKQALRAVLEGLKHNFDVTSPLPSIKDMSETDLRI
VMCAVCGDPFSVDLILSPFLDSHSCSAGQPGQSNTLILNKIIGDSRRRIQVTVLSYHSSI
GIRKDELVHGYILVYSAKRKSSMAMLRAFLAEVQDVIPVQMVAITDSQADFFENDEIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTPFFNEVLEKKSSIESAFMYDSSRDCMGA
SEDVFPQSPHSHSPAYNYYPDSEDDTEAPPPYSPIGDDVQLLPTPSERAKYRIDLEGNEY
PVHSTPLSDHERNHRVPPPVRPKPILPKSNVKKLDPNLLKTIEAGMRSNRRQRGPMAHGE
DVETSDNYADPIDTLLKSKGFSDDIYAVPEDTQSRIVKMRNSFGGLHVLHGDEENGFDRK
AQASRRPSKYKHRSKILFSKTKMYHRRVHSDVSDDESGPAMQKKKKGRAHRGSEEDPLLS
PADPWKGGIDNPAITSDPEQDDMKKKKKKTPKTKEPKKPKSKPPKPLYPPTRRNWDSNYF
GVPLQNLVTPDRPIPLFIEKCVDYIERTGLNTEGLYRVSGNKTDQDNIQKQFDQDHSVDL
IVMDVAVNAVAGALKAFFADLPDPLIPYILHPELVEAAKIVDHIERLQVLKEIVRKFPAV
NYEVFKYVITHLNRVSQQSKTTLMTADNLSICFWPTLMRPDFENKDTLSTTKLNQSVIES
FIQQSHYFFYGGDIQESSSTESTPPPHHCHSMVEALLPLQLPPPLQPQQIQHSMSLQPDP
LI
NT seq 4509 nt   +upstreamnt  +downstreamnt
atggccaagaacaaggaggcacgccccctaacatatgctgtcagtgttgttggcctctca
gggacagagaaggagaagggcaactgtggtgtgggcaagtcctgcctatgcaacagatat
gtgcgctccaacgcggacagctactacactgagcacacttctgtgttgagcacaattgac
tttggaggtcgcgtggtgaacaatgatcacttcctctactggggtgaagtgccacaccga
agtgatgacgggctcgagtgcaaaattcaaatcattgaacaaacagagttcattgatgat
cagactttcttgccccatcgcagcacaaacctgcagccctatactaaaagggctgcagcc
tccaagatacagtctgctgaaaagctgatgtacatttgcaccgaccagcttggcttggag
caggattttgatcagaagcagatggccgatgggaaactgaatgttgacggttttatattg
tgtatagacgtgagcaaaggctgcaataggaaatttgaggatcagatgaaatttgtcaac
agcctttattctcaaatggtcaaatcgaaaaagcctatcgtcattgctgcaacaaaatgt
gacgagtgcgtggagcagtatctaagggaccttcaggcattcgctgcaagcaaaaagaac
ctcctggtggtagaaacgtcagctcgatctagcatcaatgtagacctgtgttttaatgcg
ttaacccagcagatggacaaaacacgaggcaaacccaaaaccattccttatttggaggcc
tacaaagttcagagacagttagtagccacagtgtccgacaagtttgaaaagcggattgta
caaaccgtcagagattatcacacaagttggaaaatggtgagtaacacgttgaaaaaccac
cctgactatgaggaatacatcaacctggaaggcacccgaaaagctagaaacaccctcaac
aagcacatagaacagctgaagcaggaacatatcaggaaaaggagggaagaatacttcttg
agcctgccaaaaattctcaataacttgctcaacaacttggaagaacttgagaaccttagc
tggtcagaggctcaaagcatcttgaagagcagggccgagtttcaattctggtttgtggtg
ctggagcacaccccgtgggatgagacggaccaaattgacaaagtcaatgacagaagagtg
ccctttgatctcctcaaaacgtcggaaggggaaaagatttatcagaaccatgtccaacat
ctgttctcagagaaaagacggttagaaatgaaggatagattcaagaagacgttggataga
gtccatttcatcagccctggacaaccctgggaagaggtcatgtgttttgtcatggaggac
gaggcctacaagtatatcagtgaatctgatcgcagggatgtttacagccagcatcagcag
gaaatagttgaaagggccaaagaggaatttcaggaaatgctttttgaacacgccgagctg
ttttatgaccttgatttaaacgccaccccaagctgtgacaaaatgagcgagatccacact
gtgctcaacgaagagcccagatacagagccctgcagaaactggccccggacagggagtca
cttctcctcaagcacatcgggttcgtctaccaccccacaaaggagacgtgtctgagcgga
cagagctgcgttgacatgaatgtcgagcaggtactggctaacaggctagttcagctggac
cacagtcgctctaatctctactataacagtgccaacattgaaaaagtcaatctgtgtctc
ttgggaagagagggtctcgcacaagaactcgcaaatgaaatccgagcccagtccacagat
gacgagtacaccctggatgggaaaatctatgaactggagcttctgcctgttgatgtcaat
tcaacgttgctctttagccatacatgggcgtcgaccttcaaacctcacggaatcttctgt
gtcttcagctccatagagtcgctaaattgtattggcgactgcatagggcgaatcagggca
gagattgcacagaacaggagggagagatacgctcagccattgccattcattctaatccta
gcaaaccagagagacagtgtttgcaaaaatatgcctatcttgaggcatcagggccaacag
cttgcaaataagctacagtgcacctttgtagacataccctctgatactttcccgcggaag
tttaatgagttacaaattaaacaggctctcagagcagtattagaaggactaaagcacaac
tttgatgtgacgagccctctgccttccatcaaagacatgtcagagaccgacttgaggatc
gttatgtgtgccgtgtgtggggatccattcagtgtggaccttatcctttcacctttcctg
gattcacattcctgcagcgcagggcaacctggccaaagtaacactctgatcctcaacaaa
atcattggcgacagtcgcagaagaatacaggtcacagtcctctcctaccactcctccatc
ggaatcaggaaggacgagcttgtccacggatacatcctggtctactcggcaaaacgcaag
tcctccatggcgatgctcagagctttcctggcggaggtccaagacgtcatccctgttcaa
atggtggccatcacagacagtcaagccgacttctttgagaacgacgaaatcaaagagctc
atgactgaaggggagcacatcgctacggagataaccgccaaattcacagctctatactct
ctatctcagtaccatcggcagacggaagtcttcacaccgttcttcaacgaggtgctagag
aagaagagcagtatcgagagcgccttcatgtacgatagctctcgagactgcatgggtgcg
agcgaagatgtcttcccccagtctccccacagtcattcccctgcttacaattactaccct
gactcagaggatgacaccgaggctcctccaccttacagccccatcggggatgacgtgcag
cttcttccaacgcctagcgaacgtgctaagtacaggattgatctggagggaaacgagtac
cctgtccatagcacacctctcagtgaccacgagcgcaaccacagagtgcctcccccggtt
aggcccaagcctatactacccaagtccaacgtcaagaagctggaccccaatctcctgaag
accatcgaggctgggatgaggagcaacagacgacaacgcggccccatggcccacggtgaa
gacgttgagacgtccgacaattacgcagaccccatagacactctcctgaaatcaaaaggc
ttcagcgacgacatctacgctgtcccggaggatacccagagcaggattgtcaaaatgcgc
aattcgtttggggggcttcacgtcttgcacggggatgaggagaacggcttcgaccgcaag
gcacaagccagcaggaggccctcgaagtataagcaccgctcaaaaatactcttcagcaaa
accaagatgtaccacagacgtgtccactccgacgtcagcgacgatgagtctgggccggcc
atgcagaagaagaagaagggcagggcccatcggggcagtgaggaggaccccctgctctcc
cctgctgacccctggaaaggagggatagacaaccctgccatcacctctgatccagagcag
gatgacatgaagaagaaaaagaagaaaacgccaaagacaaaggaacccaaaaagccaaaa
tccaagcccccaaagcctttgtacccacccacacggaggaactgggacagcaactacttt
ggtgttcccctgcagaacctggtcaccccggaccggccaatccccttgttcattgagaag
tgtgtggactacattgaacgcactggacttaatacagagggcctgtatcgtgtgagtgga
aacaagaccgatcaagacaatattcagaagcagtttgatcaagaccacagtgtggacctg
atagtgatggacgtggctgtgaatgctgtggcgggggctctgaaggccttcttcgcagac
cttcctgatcctctcatcccctacatcttgcacccggagctggtggaggcagccaaaatt
gtggaccacatagaaagacttcaagtgctgaaagaaatagtgaggaagttccctgccgtg
aactacgaggtgtttaaatacgtcatcactcatctgaacagggtgagccagcagagtaag
actaccctgatgacggccgacaatctatccatctgcttctggcccacattgatgcgtccc
gactttgagaacaaggacacactctcaaccaccaagctcaaccagtcggtcatcgagtcc
ttcatccagcagagccactactttttctacggtggagacatccaggagagctccagcacc
gagagcaccccaccaccccatcactgtcacagcatggtggaggccctgctgcccctgcag
ctgccccctcctctccagccccaacagatccagcacagtatgtccttgcagcctgaccca
ctcatatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112256837
Entry
112256837         CDS       T05605                                 

Definition
(RefSeq) rho GTPase-activating protein 5-like
  KO
K13709  Rho GTPase-activating protein 5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112256837
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112256837
Membrane trafficking [BR:otw04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    112256837
SSDB
Motif
Pfam: RhoGAP-FF1 FF Ras NOG1 GTP_EFTU Cdh1_DBD_1 DUF4604
Other DBs
NCBI-GeneID: 112256837
NCBI-ProteinID: XP_024286145
LinkDB
Position
8
AA seq 1295 aa
MAKNKEARPPTYAVSVVGLSGTEKEKGNCGVGKSCLCNRYVCSNADGYYTEHTSVLSTID
FGGRVVNNDHFLYWGEVPHRSDDGLECKIQIIEQTEFIDDQTFLPHRSTNLQPYSKRAAA
FKLQSAEKLMYICTDQLGLEQDFDQKQMADGKLNIDGFLLCIDVSKGCNRKFEDQMKFVN
SLYSQMVKSKKPIVIAATKCDECMEQYLRDLQVFAASKKNLLVVETSARLRINVDLCFNA
LTQQMDKTRGKPKIIPYLEAYKVQRQLVATVSDKFEKRIVQTVRDYHTSWKTVSNMLKNH
PDYEEYINLEGTRKARNTLNKHIEQLKQEHIWKRREEYFSSLPKILNNLLNNLEELENLS
WSEAQSILKSRAEFHFWFVVLEHTPWDETDQIDKVNDRRVPFDLLKTLEGEKIFQNHVQH
LFSEKMRLEMKNRFKKTLDRVHFISPGQPWEEVMCFVMEDEAYKYISESDHRDVYSQHQQ
EIVERAKEEFQEMLFEHAELFYDLDLNATPSCDKMSEIHTVLNEEPRYRALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQSCVDMNVEQVLANRLVQLDHGRSNLYYNSANIDKVNLCL
LGREGLAQELANEIRAQSTDEEYTLDGKIYELELLPVDVNSTLLFSHTWASTFKPHGIFC
VFSSIESLNCIGDCVGRIRAEIAQNRRERYAPPLPFILILANQRDSVCKNMPILRHQGQQ
LANKLQCTFVDIPSVTFPRKFNEFQIKQALRGVLEGLKHNFDVMSPLPSIKDMSETDLRI
VMCAVCGDPFSVDLILSPFLDSHSCSAGQPGQSNTLILNKIIGDSRRRIHVTVLSYHSSI
GIRKDELVHGYILVYSAKRKSSMAMLRAFLAEVQDVIPVQMVAVTDSQADFFENDPIKDL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTPFFNEVLEKKSSIESAFMFDSSRDCTGA
SEDVFPQSPHSHSPAYSYYPDSEDDTEAPPPYSPIGDDVQLLPTLSERGKCRIDLEGNEY
PVHSTPVGDQERNHRVPPPVRPKPILSKPNVKKLDPNLLKTIEAGMRSNRRQRSPMAQGE
DVEASDNYADPVDTLLKSKGFTDNIYAVPEDTHSRTLKMLHVSHGDEENGFDHKAQASRR
PTKYKHRSKILFSKTKMYHRRVHSDVSDDESGPAMQKKKKGRAHRGSEEDPLLSPADPWK
GGIDNPAITSDPEQDDMKKKKKKTPKTKEPKKPKSKPTKPLYPPTRRNWESHYFGVPLQN
LVTPDRPIPLFIEKCVDYIERTGRLFYIISPSSLI
NT seq 3888 nt   +upstreamnt  +downstreamnt
atggccaagaacaaggaggcacgccccccaacatatgctgttagtgttgtcggcctctca
gggacagagaaggagaagggcaattgtggcgtgggcaagtcctgcctatgcaacagatat
gtgtgttccaacgctgacggctactacactgagcacacttctgtgttgagcacaattgac
tttggaggtcgtgtggtgaacaatgatcacttcctctactggggtgaagtgccacaccga
agcgatgacgggctcgagtgtaaaattcaaattattgaacaaaccgagttcattgatgat
cagactttcttgccacatcgcagcacaaacctgcagccctatagtaaaagggctgcagcc
ttcaagctacagtctgctgagaagctgatgtacatttgcaccgaccagcttggcctggaa
caggattttgatcagaagcagatggccgatgggaaactcaacattgacggttttttattg
tgcatagacgtgagcaaaggctgcaataggaaatttgaggatcagatgaaatttgtcaac
agcctttattctcaaatggtcaaatcgaaaaagcccatcgtcattgctgcaactaaatgt
gacgagtgcatggagcagtatctaagggaccttcaggtgttcgctgcaagcaaaaagaac
ctcctggtggtagaaacgtcagctcgattgagaatcaatgtagacctctgttttaacgca
ttgacccagcagatggacaaaacacgaggcaaacccaaaatcattccttatttggaggcc
tataaagttcagcgacaattagtagccacagtgtccgacaagtttgaaaagaggattgta
caaaccgtcagagattatcacacaagttggaaaacagtgagtaacatgttgaaaaaccac
cccgactatgaggaatacatcaacttggaaggcacccgaaaagctagaaacaccctcaac
aagcacatcgaacagctgaagcaggaacatatctggaaaaggagggaagaatacttctcg
agcctgccaaaaattctcaataacttgctcaacaacttggaagaactcgagaacctgagc
tggtcggaggctcaaagtatcttgaagagcagggctgagtttcatttctggtttgtggtg
ctggagcacactccgtgggatgagacggaccaaattgacaaagtcaacgacagaagagtg
ccctttgatctccttaaaacgttggaaggggagaagatttttcagaaccatgtccagcat
ctgttctcagagaaaatgcggttagaaatgaagaatagattcaagaagacattggataga
gtccatttcatcagccctggacaaccctgggaagaggtcatgtgttttgtcatggaggac
gaggcctacaagtatatcagtgaatctgatcacagggatgtttacagccagcatcagcag
gaaatagttgaaagggccaaagaggaatttcaggaaatgctttttgaacacgcagagctg
ttttatgaccttgatttaaatgccaccccaagctgtgacaaaatgagcgagatccacact
gtgctcaacgaggagcccagatacagagctctgcagaaactggcccctgacagggagtca
cttcttctcaagcacatcgggttcgtctaccaccccacgaaggagacgtgtctgagcgga
cagagctgcgttgacatgaatgtcgagcaggtactggctaacaggctagttcagctggac
catggtcgctctaatctctactataacagtgccaacattgataaagtcaatttgtgtctc
ttgggaagggagggtctcgcacaagaacttgcaaatgaaatccgagcccagtccacagac
gaggagtacaccctggatgggaaaatctatgaactggagcttctgcctgttgatgtcaac
tcaacgttgctctttagtcatacgtgggcgtcaaccttcaaacctcacggaatcttctgt
gtcttcagctccatagagtcgctaaattgtattggcgactgcgtagggagaatcagggca
gagattgcacagaacaggagggagagatacgcaccgccattgccattcattctaatccta
gcaaaccagagagacagcgtttgcaaaaatatgcctatattaaggcatcagggccaacag
cttgcaaataagttacagtgcacctttgtagatataccttctgttacctttccacggaag
tttaacgagttccaaattaaacaggctctcagaggagtattagaaggactaaagcacaac
tttgatgtgatgagccctctgccgtccatcaaagacatgtcagagaccgacttgaggatt
gttatgtgtgctgtgtgtggggatccatttagtgtagacctcatcctctcacctttcctg
gattcacattcctgcagcgcagggcaacctggccaaagtaacactctgatcctcaacaaa
atcattggcgacagtcgcagaagaatacatgttactgtcctctcctaccactcctccatc
ggaatcaggaaggacgagctcgtccatggatacatcctggtctactcagcaaaacgcaag
tcctccatggcgatgctcagagctttcctggcggaggtccaagatgtcatccctgttcaa
atggtggccgtcacagacagtcaagcagacttctttgagaatgacccaatcaaagacctc
atgactgaaggagagcacatcgctacagagataaccgctaaattcacagctctctactct
ctgtctcagtaccatcgtcagacggaagtcttcacgccgttcttcaacgaggtgctagag
aagaagagcagcatcgagagcgccttcatgtttgacagctctcgagactgcacgggtgcg
agtgaagatgtcttcccccagtctccccacagccattcccctgcttacagttactaccct
gactcagaggacgacaccgaggctcctccaccttacagccccatcggggacgacgtgcag
cttcttccaacgcttagcgaacgtggaaagtgcaggatcgatctggaggggaacgagtac
cctgtccatagcacacctgtcggtgaccaagagcgcaaccacagagtgcctcccccggtt
agacccaagcctatactatccaagcccaacgtcaagaagttggaccccaatctcctgaag
accattgaggctgggatgaggagcaacagacgacaacgcagccccatggcccaaggtgaa
gacgtcgaggcgtccgacaattacgcagaccccgtagacactctcctgaaatcaaagggc
tttaccgacaacatctacgctgtcccggaggacacccacagcaggaccctcaaaatgctt
cacgtctcacacggggacgaggagaacggcttcgaccacaaggcgcaggccagcaggagg
cccaccaagtataagcaccgctccaaaatactcttcagcaaaaccaagatgtaccacaga
cgtgtccactccgacgtcagcgatgatgagtctgggccggccatgcagaagaagaagaag
ggcagggcccatcggggcagtgaggaagaccccctgctgtcccctgctgacccctggaag
ggagggatagacaaccctgccatcacctccgatccagagcaggatgacatgaagaagaaa
aagaagaaaacgccaaagacaaaggaacctaaaaagccaaaatccaagcccacaaagcct
ttgtaccctcccacacggaggaattgggagagccactactttggtgttcccctacagaat
ctggtcaccccggaccggccaatccccttgttcattgagaagtgtgtggactacattgaa
cgcactggtaggttattttatatcatttctccctcatccctgatttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112257727
Entry
112257727         CDS       T05605                                 

Definition
(RefSeq) rho GTPase-activating protein 35-like
  KO
K05732  glucocorticoid receptor DNA-binding factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112257727
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112257727
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112257727
Membrane trafficking [BR:otw04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    112257727
SSDB
Motif
Pfam: RhoGAP-FF1 RhoGAP Ras FF Cdh1_DBD_1 NOG1
Other DBs
NCBI-GeneID: 112257727
NCBI-ProteinID: XP_024287283
LinkDB
Position
9
AA seq 1369 aa
MMAKKQDAKSPTYNLIVVGLSGTEKEKGQCGVGKSCLCNRFVRPSADDFYLDHTSVLSTS
DFGGRVVNNDHFLFWGEVGRVVEEGPECRMHVVEQTEFIDDQTFQPHRSTAMQPYIKRAA
STKLASAEKLMYFCTDQLGLEQDFEQKQMPEGKIQADGFMLCMDVSRGMNRNFDDQLKFV
TNLYGHLSKTKKPIVLVLTKCDEGVERYIKDSHTFAITKKSLPVVETSARSNINVDLAFI
ALVQLIDKSRGKPKIIPYFEALKLQSQQIALAKDRYEWLVNRIVKNHNETWLNTSRRMHS
SSEFKEYVFLEGTAKCKKLFQQHVYRLKQEHIERRRKIYLSTLPLALSSLVPDLDEIDQL
SWSGVQKVLESKQHFAHWFVVLEDSPWEDTSHIDNMEDERIPSDLLETAPAEYIFNAHLE
HLRNECKRAEMRQEFKHKLACSPFVTPGKPWEEARSFIMNEDFYQWLEESEYLDLYNRHQ
KEIIDHAKEDFQELLLEYSELFYELEVDAKPSKEKMGAIQEVLGEEQRFKTLQKLPAERD
ALVLKHIHFVYHPTKETCPSSPQCGDFKIEQLLASRFPTCYPFFNVKSHFGDIKADRINL
VILGKDGLAREFANEIRTLCTNDDRYVLDGKMYELTLRPIEGNVRLPVNSFHTPTFTPHG
CLCLYNSKESLTYVVESIERLRESTIGRRDSHIAQLLTSLLLVTKRGVGTYADIGGETAL
GLIKQGQQVARRLQCSFLDPASPGVGYGHNVNDSQINQVLRGLLDSRRSSSFSSSSPPLP
PKPPGPRDSPHQPSPEADIRIVMCLMCGDNYDVEQLLSPFLLPQHCRPTSNSGTSVILEQ
TVGPHKQVIELSLLSYHASFSLRKSRLVHGYIAVYSARRKASLETLCAFLCEIQDIIPVQ
LLAVGESQVELTESESAREQLVQGEELAQEIEGRFNSVVCGSGGVVGGLHRIEMFQHFLM
EVVEKRNIVEATHMYDNVAEACTNDTAYSPRCSSPSPGNMFLDSDVDDVEPSPPYFDGTL
TSHGGGFNLPDLDSSDVSVISDISSFENKLNSKVPPQVRPKPTVTFDFRKVGRNPYNTDT
MGHRRSLPSAVTWVPGGDGGYDPSDYAEPMDAVSKPRPSNEEIIYSVPHDSTQGKIITIR
NANRMHSNGNGSDSEADSSSLERCRKFSAAGVKPRLYRDRSKRLGKFSSFRTSFIGSDDE
MGALPKTKEDEFGTLKGDIINEEGEDPKKRNILKSLRRTAKKTRPKPRPSIPKPLESNYF
GVPLINVVFPDRPIPLFIDKCVHFIETTGLNTEGLYRVSGNKCEMESMQRQFDQDHGLDL
VEKDFAINTVAGALKAFFSELPEPLVPCILQVELLEAFKINDREQSATP
NT seq 4110 nt   +upstreamnt  +downstreamnt
atgatggcgaaaaagcaggatgcgaagtcacccacatacaaccttattgttgtgggtttg
tcagggacggagaaagagaagggccagtgtggagtgggtaagtcctgcctgtgcaaccgc
tttgtgcgccccagtgctgatgacttctatctggaccacacgtcagtgctgagcaccagc
gactttgggggcagagtggttaacaatgaccacttcctgttctggggggaggtggggcgg
gtggtggaggaggggccggagtgcaggatgcatgtggtggagcagaccgagttcattgat
gaccagacattccagccacaccgcagcactgccatgcaaccctacatcaagagggcggcc
tccaccaagctggcctctgcagagaagctgatgtacttctgcacggaccagctggggctg
gagcaggactttgagcagaagcagatgcctgagggcaagatacaggctgacgggttcatg
ctctgtatggatgtcagtagggggatgaaccgcaactttgacgaccagttgaagtttgtc
acaaacctttacggtcatctgagcaaaacaaagaagcccattgtgctcgtcttaaccaag
tgtgatgagggggttgaacgctacatcaaagattctcacacctttgccatcactaaaaag
agtcttccagtagtggagacatctgcacgctctaacatcaatgttgacctagccttcatt
gctttggtgcaactcattgataagagcaggggcaagcccaagatcattccttactttgaa
gccctcaagctccagagtcagcagatagccctggctaaagaccgatacgaatggctagtc
aaccgcatagtgaagaaccacaacgagacctggcttaacaccagccgacgcatgcacagc
tcctcagagttcaaggaatacgtctttctagagggtacagcgaaatgcaagaagctcttc
cagcagcatgtgtaccgcctgaaacaggagcacattgagagacgtcggaaaatctatctg
agcactcttcctctagcacttagctccctggtgcctgacctggatgagatcgaccagctg
agctggtctggggttcagaaggtcctggagtccaagcagcactttgcccattggtttgtg
gttttggaggactctccatgggaggacacgtctcacatagataacatggaggatgagcgc
atcccgtcagacctgttggagacggccccagccgagtacattttcaacgcccacctggag
cacctgaggaatgagtgcaagcgggccgagatgaggcaggagttcaagcacaagctggcc
tgttctccctttgtcacgccaggcaagccctgggaagaggcccgcagcttcatcatgaac
gaagacttctaccaatggttggaggaatcagagtacctggacctctacaaccgccaccag
aaagagataatagaccacgctaaagaggacttccaggagctgctgctggagtattctgag
ctcttctatgagctggaggtggatgccaagcccagcaaggagaagatgggggccatccag
gaggttctaggggaggaacagaggttcaagactctgcagaagcttccagctgagagagat
gctctggtgttgaagcatatccactttgtctaccacccaaccaaggagacctgtcccagc
agcccacagtgtggagacttcaagatagagcagctcctggcctcacgtttcccaacatgc
tacccattcttcaatgtgaagtcccattttggggatattaaagctgaccgaatcaacctt
gtgatattgggcaaagacggactggccagggagtttgccaatgagatcaggactctgtgt
accaatgacgaccggtatgtgctggatgggaaaatgtatgagctgaccctgcgacctatc
gagggaaacgtacgacttcctgtaaattcctttcacactcccactttcacaccccatgga
tgcctgtgtctgtacaactcaaaagagtccctaacttacgtcgtagaaagcattgaaagg
ttgcgggagtcaactataggtagaagggatagccatatagctcagcttttaacatctctg
ctcttggttactaaaaggggagtagggacatatgcagatattgggggagaaactgcctta
ggcctaataaaacagggacagcaggtagcaaggagactgcagtgtagcttcctagaccca
gcctctcctggtgtgggctatgggcacaatgtgaatgacagtcagatcaatcaagtattg
aggggtctcctggactctaggaggagctcatcttttagtagcagctccccacctctgccc
cctaaacctccaggcccaagagactctcctcaccagcccagcccagaggcagacatccgc
atcgtcatgtgcttgatgtgtggagacaattacgacgtggaacagctcctctctcccttc
ctactgcctcagcactgcaggccaacatccaatagtgggacctcagtgatactggagcag
acagtggggcctcacaaacaggtgattgagctctcccttctttcctaccacgcctccttc
tccctgaggaagagcagattagtgcatggctacattgctgtgtactcagcccgccgcaag
gcctccctggagactctatgtgccttcctgtgtgagatccaggacatcatccctgttcag
ctgctggcagtaggggagagccaggtggagctcacagaaagtgagtctgccagagagcag
ctagtccagggagaggagctggcccaagagatagaaggcaggttcaacagtgtggtgtgt
gggtctggaggggtggtgggcggcctgcacaggatagagatgttccagcacttcctgatg
gaggtggtggagaaacgcaacattgtggaggcaacacacatgtatgataacgtggctgag
gcctgcactaacgacactgcctactcccctcgctgtagctcacccagccctggcaacatg
ttcctagactctgatgtggatgacgtggagccctccccaccctacttcgatggcacactc
acctcccatggtgggggcttcaacctgcctgacctggactccagcgatgtctcggtcatc
tctgacatcagctcctttgagaacaaactcaacagcaaggtccctccccaggtgaggccc
aagcccactgtgacctttgacttccggaaggtgggccgaaacccctacaacacggatacc
atgggccaccgtcgctccctgccctctgctgtgacatgggtaccaggtggggacggaggt
tacgacccctcagactatgcagagcctatggatgctgtgtccaagccccggcccagcaac
gaggagatcatctactctgtgccccatgacagcacgcagggcaagataatcaccatccgc
aacgccaacaggatgcactcaaatggaaacggctcggacagtgaggcagacagcagttcc
ctggagcgctgcaggaagttctcggcggcgggggtgaagccccggctgtaccgggaccgc
tccaaacgcctgggtaagttcagcagctttcgcactagcttcattggcagcgacgacgag
atgggggccctgccaaagaccaaggaggatgagttcggaaccctgaaaggagacatcatc
aatgaggagggagaggaccccaagaagaggaacattctgaagagcctacggcgaactgcc
aagaaaaccagaccaaagcctcggccctctattcccaagcccctggagagcaactacttc
ggggtacccctgatcaatgtggtgttcccagacagacctatcccactttttattgacaag
tgtgtccacttcattgagaccaccggcctcaacacagaggggctgtacagggtgagcggg
aacaagtgtgagatggagagcatgcagaggcagtttgaccaggaccatgggctggaccta
gtggagaaggactttgccatcaacacggtggctggggctctgaaggccttcttctctgag
ctgccggagccattggtgccctgcattctgcaggtggagctgctcgaggccttcaaaatc
aatgacagggaacaaagcgctacaccatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265084
Entry
112265084         CDS       T05605                                 

Definition
(RefSeq) rho GTPase-activating protein 35-like isoform X1
  KO
K05732  glucocorticoid receptor DNA-binding factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112265084
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112265084
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112265084
Membrane trafficking [BR:otw04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    112265084
SSDB
Motif
Pfam: RhoGAP-FF1 Ras RhoGAP FF GTP_EFTU Cdh1_DBD_1 NOG1
Other DBs
NCBI-GeneID: 112265084
NCBI-ProteinID: XP_024297890
LinkDB
Position
13
AA seq 1318 aa
MMAKKQDAKAPTYNLVVVGLSGTEKEKGQCGVGKSCLCNRFVRPSADDFYLDHTSVLSTS
DFGGRVVNNDHFLFWGETGRVLEEGPECRMHVVEQTEFIDDQTFQPHRSTALQPYIKRAA
SNKLASAEKLMYFCTDQLGLEQDFEQKQMPEGKLMVDGFLLCVDVSRGMNRNFDEQMKFI
TNLYNQLAKNKKPVVLVLTKCDEGVERYIKDSHTFALAKKNLQVVETSARSNVNVDLAFL
TLVQLIDKGRGKPKIIPYFEALKQQSQQIASAKDHYEWQVSRIVKNHNETWPNINRRMQT
SPEYKEYVFLEGTAKAKKLFQQHVHRLKQEHIERRRKVYLSTLPQALVSLVPELDEIDHL
SWSGVQKVLETKRDFSHWFVVLDDTPWETTPHIDNMEDERIPEDLLETPVAETIYESHLE
HLRNERKKAEMKWEFKEKLSASPFITAGKPWEEARSFIMNEDFYQWLEEQEYLDIYNRHQ
KEIIDRAKEDFQELLLEYSELFYELEVDAKPSKEKMGAIQEVLGEEQRFKALQKLQAERD
ALVLKHIHFVYHPTKETCPNSPHCVDCKIEQVLASKFPTRYSFFDSHKPGDGNADRINLV
ILGKDGLGRELANEIRALCTNDDRYVLDGKMYELSLRPIEGNVRLPVNSFHTPTFTPHGV
LCLYNSKESLSYIVESIEKLRESTLGRRENSLFQLPMNLLLVTKRGVGSVRDIGGETAHT
LILQGQQVAGKLQCGYLDPASPGVGYGRNVNEKQINQVLKGLLECRRPPGSIGSSSPPLP
PSFRDSHSQPIPETDLRIVMCLMCGDDYDVEQLLSPLLLPQHCRPASSLSSGTSVLLELT
VGAQRHTIDLSLLSFHSSFALRKSRLVHGYIAVYSARRKASMETLCAFLCEVQDIIPVQL
LAVGESQAELSDSEVAREQVSQGEELAREIEARFNTVVCGPGGVVGGLHRIDLFQPFLKE
VVEKRTIVEATHMYDNVAEACTTESMSPARCNSPSPINTLLDSEEDVEPSPHYPDGTPTS
HLGGFKLPDLESSDAFSVISEISTFESKLNNKVPPQVRPKPPVRKVNLGPYMDQQGTNRR
SLPPAVTWAPGSDGGYDPSDYAEPVDAVIKQRPTEEESIYSVPHDSTQGKIITIRNANKH
SNGGGNGSDSEADSSSLERRRKMSALGVKPRLYRDRSKRLGKFSSFRTSFSIGSDDELGP
PKAPEELGGAHKGENSINEEGEDPKRRNILRSLRRNTKKPRPKPRHSVSKVESNYFGVPL
ANVVTPDRPIPLFIDKCIRYIEATGITTEGIYRVSGNKSEMESMQRQFDQGESPEPLF
NT seq 3957 nt   +upstreamnt  +downstreamnt
atgatggcaaaaaagcaagatgcaaaggcgcccacctacaacctggtcgtggtgggcctg
tccggcacagagaaagagaaggggcagtgtggcgtgggcaagtcctgcctgtgcaaccgc
ttcgtccgtcccagcgcagacgacttttacctggaccacacctccgtgctaagcaccagc
gacttcggagggcgcgtggtgaacaatgaccacttcctgttctggggggaaacagggcgg
gtgctggaggaggggccggaatgcaggatgcatgtggtggaacagacagagttcattgat
gaccagacgttccagccgcaccgttccacagccctccagccctacatcaagagggcagct
tccaacaagctggcctctgcagaaaagctgatgtatttctgcacagaccagcttgggctg
gagcaggactttgagcagaagcagatgcctgaggggaagctgatggtggatggctttctc
ctctgtgtggacgtcagcaggggcatgaaccgcaactttgacgaacagatgaagttcatc
actaatctctacaaccagctagccaagaacaagaagccagtagttctggtgctcaccaag
tgcgacgagggggtggagcgctacatcaaggactcgcacaccttcgccctggccaagaag
aacctccaggtggtggagacgtcagcacgctccaacgtcaacgtagacctggccttcctc
accctggtgcagctgatagacaagggccggggcaaacccaagatcatcccctactttgag
gccctgaagcagcagagccagcagatcgcctcggctaaagaccactacgaatggcaggtc
agccgcattgtgaagaaccacaatgagacgtggcccaacataaatcggcgcatgcagacc
tccccagagtacaaggagtatgtcttcctggagggcacggccaaagccaagaagctcttc
cagcagcacgtccacaggctcaaacaggagcacattgagcgaaggcggaaggtctatctc
agcaccctgcctcaggcactggtttccctagtccctgagctggatgagatcgaccacctg
agctggtccggggtccagaaggttctggagaccaaacgggacttctcccattggttcgtt
gtgttggacgacaccccctgggagaccacgccacacatagacaacatggaggacgagagg
attccagaggatctcctggagacccctgtggctgagacaatttatgagagccacctggag
cacctgagaaacgagcgcaaaaaggcggagatgaagtgggagttcaaggagaagctcagt
gcctctccctttatcacagcaggcaagccctgggaggaggcacgcagcttcatcatgaat
gaagacttctaccagtggcttgaggaacaagagtacctagacatctacaacaggcaccag
aaggagatcatcgaccgagccaaggaggacttccaggagctgctgctggagtactcagag
ctcttctatgagctggaggtagacgccaagccaagtaaggagaagatgggggccatccag
gaggtgttgggggaggagcaaaggttcaaggccctgcagaagttacaggcagagagggac
gctttggttctcaagcatatccactttgtctaccaccccaccaaggagacctgcccaaat
agcccccactgtgtggactgtaagattgaacaggttctagcctccaagttccccactcga
tactccttctttgatagccataaaccaggtgacgggaatgcagatcggattaacctggtc
attctgggtaaagacggcctgggtagagaactggccaatgagatcagggctttgtgcact
aatgacgaccggtacgtgctggatgggaaaatgtatgagttgtccctccggcccatagag
ggcaacgttcggctgccggtcaattccttccacacgcctaccttcaccccccatggcgtc
ctgtgtctctacaactctaaggagtcactatcctacattgtggagagcattgaaaagctc
agagagtccacgctaggccgaagggaaaacagtctatttcagctgcccatgaacctgctc
ctagtcaccaaacggggagtagggtccgtcagggacattgggggggagacggcccacaca
cttatcctccaggggcagcaggtggctgggaagctacagtgtggttacctagaccccgcc
tcccctggggtgggctatggacgcaatgtgaacgaaaagcagatcaaccaggtgttaaaa
ggtctgttagaatgccgtaggccccctgggagcataggcagcagctcccctcctttaccc
ccttccttcagagactctcactcccagcccatccccgagacagacctgcggatagtcatg
tgcctgatgtgtggggacgattatgacgtggagcagctcctctcgcctctcctgctgccc
cagcactgtcggccggcctccagcctgagcagtggcacgtccgtgctcctagagctcacg
gtgggggctcagaggcacaccatcgacctctccctgctctccttccactcctcatttgcc
ctacggaagagccggctggtgcacggctacatcgccgtgtattcggccaggcgcaaggca
tccatggagaccttgtgtgcgttcctgtgcgaggtgcaggacatcatccccgtgcagctg
ctggcggtgggggagagtcaggctgagctgtcggactctgaagtggccagggagcaggtg
agccagggggaggagctggcccgggagatcgaggccaggtttaacacagtagtgtgtggg
cctggaggggtggtgggaggcctgcacaggatagacctcttccagcccttcctgaaggag
gttgtggagaaacgcaccatagtggaggccacacacatgtacgataatgtagcagaggcc
tgcaccactgagagcatgagcccggcccgctgcaattcccccagccccatcaacaccctg
ctagactctgaggaggatgtggagccctcgccccactaccccgatggtacccccacctcc
cacctggggggtttcaagctccctgacctggagtccagcgacgccttctcagtcatctcc
gagatcagcaccttcgagagcaagctcaacaacaaggtgcccccgcaggtacggcccaag
ccccctgtacggaaagtcaacctggggccctacatggaccagcaagggaccaaccgccgc
tctttaccgcctgctgtcacctgggcgccgggcagcgacggtggctacgacccctcggac
tacgcagagcccgtggatgccgtgatcaaacagcggcccacggaggaggagagcatctac
tcggtgccccacgacagcactcagggcaagatcatcaccatccgcaacgccaacaagcat
tctaacggcgggggcaatggctcggatagcgaggctgacagcagctccctggagcggagg
cggaagatgtctgctctgggggtgaagccgcggctgtaccgcgaccgctcgaaacgcctg
ggcaagttcagcagcttccgcactagcttctctatcggcagtgacgacgagctggggcca
cccaaggcaccagaggagctgggcggggcgcacaagggggagaactctattaacgaggag
ggtgaggaccccaagaggaggaacatcctcaggagcctgcgcagaaacaccaagaaaccg
cggcccaagcccaggcactccgtatccaaagtagaaagcaactactttggcgtgccattg
gccaacgtggtgacacctgaccgacccatcccgctcttcatcgacaagtgcatccgatat
attgaggcaacaggtatcactactgaagggatctacagggtgagtgggaacaagtcagaa
atggagagcatgcagaggcagtttgaccagggtgagtcaccagaacctctcttttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112266677
Entry
112266677         CDS       T05605                                 

Definition
(RefSeq) rho GTPase-activating protein 35-like
  KO
K05732  glucocorticoid receptor DNA-binding factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112266677
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112266677
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112266677
Membrane trafficking [BR:otw04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    112266677
SSDB
Motif
Pfam: RhoGAP RhoGAP-FF1 Ras FF Cdh1_DBD_1 GTP_EFTU NOG1
Other DBs
NCBI-GeneID: 112266677
NCBI-ProteinID: XP_024300125
LinkDB
Position
14
AA seq 1541 aa
MMMAKKQDAKAPTYNLVVVGLSGTEKEKGQCGVGKSCLCNRFVRPSADDFYLDHTSVLST
SDFGGRVVNNDHFLFWGETGRVLEEGPECRMHVVEQTEFIDDQTFQPHRSTALQPYIKRA
ASNKLASAEKLMYFCTDQLGLEQDFEQKQMPEGKLMVDGFLLCVDVSRGMNRNFDDQMKF
ITNLYNQLAKNKKPVVLVLTKCDEGVERYIKDSHTFALAKKNLQVVETSARSNINVDLAF
LTLVQLIDKGRGKPKIIPYFEALKQQSQQIASAKDRYEWLVSRIVKNHNETWPNINRRMQ
TSSEYKEYVFLEGTAKAKKLFQQHVHRLKQEHIERRRRAYLSTLPQALGSLVPELDEIDH
LSWSGVQKVLETKQDFSHWFVVLDDTPWETTPHIDNMEDERIPQDLLETPVAETIYESHL
EHLKNERKRAEMRWEFKEKLSASPFITAGKPWEEARSFIMNEDFYQWLVEPEYLDIYNRH
QKEIIDRAKEDFQELLLEYSELFYELEVDAKPSKEKMGAIQEVLGEEQRFKALQKLQAER
DALVLKHIHFVYHPTKETCPNSPHCVDCKIEQVLASKFPTRYSFFDSHKPGDGNADRINL
VILGKDGLGRELANEIRALCTNDDRYVLDGKMYELSLRPIEGNVRLPVNSFHTPTFTPHG
VLCLYNSKESLSYIVESIEKLRESTLGRRENSLFQLPMNLLLVTKRGVGSIRDIGGETAH
TLILQGQQVAGKLQCGYLDPASPGVGYGRNVNEKQINQVLKGLLECRRPPGSIGSSSPPL
PPSFRDSHSQPIPETDLRIVMCLMCGDDYDVEQLLSPLLLPQHCRPASSLSSGTSVLLEL
TVGAQRHTIDLSLLSFHSSFALRKSRLVHGYIAVYSARRKASMETLCAFLCEVQDIIPVQ
LLAVGESQAELSDSEAAREQVSQGEELAREIEARFNTVVCGAGGVVGGLHRIDLFQPFLK
EVVEKRTIVEATHMYDNVAEACTTESMSPARCNSPSPINTLLDSEEDVEPSPPYPDVTLT
SHLGGFKLPDLESSDAFSVISEISTFESKLNNKVPPQVRPKPTIRKVNLGPYMDQQGTNR
RSLPPAVTWAPGSDGGYDPSDYAEPVDAVTKQRPTEEESIYSVPHDSTQGKIITIRNANK
HSNGGGNGSDSEADSSSLERRRKMSALGVKPRLYRDRSKRLGKFSSFRTSFSIGSDDELG
PPKAPEELGGAHKGDNSINEEGEDPKRRNILRSLRRNTKKPRPKPRHSISKVESNYFGVP
LANVVTPDRPIPLFIDKCIRYIEATGITTEGIYRVSGNKSEMESMQRQFDQDHNLDLVEK
DFTINTVAGAMKAFFSELPEPLVPYSHQIELVEAFKINDRDQRVHAMKDILRRFPRENYD
VFKYVINHLNKVSQNNRLNLMTSENLSICFWPTLMRPDFTTMDALTATRTYQTIIESFIH
QCAFFFYNQPLSDTPGGHASPTATLSSHGGTSAYSSLAYNSPTLTPAPAPYVMPATPPVI
PHYGPPHTQIQHSPPHTPLPPIQALLPPLHPHHPPTEQHML
NT seq 4626 nt   +upstreamnt  +downstreamnt
atgatgatggcaaaaaagcaagatgcaaaggcgcccacctacaacctggtcgtggtgggc
ctttccggcacagagaaggagaaggggcagtgtggtgtgggcaagtcctgcctgtgcaac
cgcttcgtccgtcccagcgcagacgacttttacctggaccacacctccgtgctaagcacc
agcgacttcgggggacgtgtggtgaataatgaccacttcctgttctggggggaaacgggg
cgggtgctggaggaggggccggagtgcaggatgcatgtggtggagcagacagagttcatt
gatgaccagacgttccagccacaccgttccacagccctccagccctacatcaagagggct
gcctccaacaagctggcctctgcagagaagttgatgtatttctgcacggaccagctaggg
ctggagcaggactttgagcagaagcagatgccagaggggaagctaatggtggatggcttc
ctcctctgtgtggacgtcagcaggggcatgaaccgcaactttgacgaccagatgaagttc
atcactaatctctacaaccagctagccaagaacaagaagccagtggttctggtgctcacc
aagtgcgacgagggggtggagcgctacatcaaggactctcacacctttgccttggccaag
aagaacctccaggtggtggagacgtcagcacgctccaacatcaacgtagacctggccttc
ctcaccctggtgcagctgatagacaagggccggggcaaacccaagatcatcccctacttt
gaggccctgaagcagcagagccagcagattgcctcggctaaagaccgctatgagtggctg
gtcagccgcatcgtgaagaaccacaatgagacgtggcccaacataaaccggcgcatgcag
acctcctcagagtacaaggagtatgtcttcctggagggcactgctaaagccaagaagctc
ttccagcagcacgtccacaggctcaaacaagaacacattgagcgaaggcggagggcctat
ctcagcaccctgcctcaggcactgggttccctagtccctgagctggatgagatcgaccac
ctgagctggtccggggtccagaaggttctggagaccaagcaagacttctcccattggttt
gttgtgttggatgacaccccctgggagaccaccccacacatagacaacatggaggatgag
aggattccccaggatctcctggagaccccggtggctgagacgatttacgagagccatctg
gagcacctgaaaaatgagcgcaaacgagcggagatgaggtgggagttcaaggagaagctc
agtgcctctcccttcatcacagcaggcaaaccctgggaggaggcacgcagcttcatcatg
aatgaagacttctatcagtggctcgtggaaccagagtacctagacatctacaacaggcac
cagaaggagatcattgaccgagccaaggaggacttccaggagctgctgctggagtactca
gagctcttctatgagctggaggtagacgccaagcccagtaaggagaagatgggggccatc
caggaggtgttaggggaggagcaaaggttcaaggccctgcagaagttgcaggcagagagg
gacgctttggttctcaagcatatccactttgtctaccaccccaccaaggagacctgccca
aatagcccacactgtgtggactgtaagattgaacaggttctagcctccaagttccccact
cgatactccttcttcgatagccataaaccgggcgatgggaacgcagatcgcataaacctg
gtcattctgggtaaagatggcctggggagagaactggccaatgagatcagggctttgtgc
accaatgatgaccggtacgtgctggatgggaaaatgtatgagttgtccctccggcccata
gagggtaacgtgcgtctgccggtcaattccttccacacgcctaccttcaccccccatggc
gtcctgtgtctctacaactctaaggagtcactatcttacattgtggagagcattgagaag
ctcagagagtccacgctaggccgaagggaaaacagtctatttcagctgcccatgaacctg
ctcctagtcaccaaacggggagtagggtccatcagggacattgggggggaaacggcccac
acacttatcctccaggggcagcaggtggctgggaagctacagtgtggttatctagacccc
gcctcccctggggtgggctatggacgcaatgtgaatgaaaagcagatcaaccaggtgtta
aaaggtctgttagaatgccgtaggccccctgggagcataggcagcagctcccctccttta
cccccctccttcagagactctcactcccagcccatccccgagacagacctgcggatagtc
atgtgcctgatgtgtggcgacgattatgatgtggagcagctcctctcgcccctcctgctg
ccccagcactgtcggccggcctccagcctgagcagtggcacgtccgtgctcctagagctc
acggtgggggcccagaggcacaccatcgacctctccctgctctccttccactcctcattt
gccctaaggaaaagccggctggtgcacggctacattgctgtgtattctgccaggcgcaag
gcgtccatggagaccctgtgtgcgttcctgtgtgaggtgcaggacatcattcccgtgcag
ttgcttgcggtgggggagagccaggctgagctgtcggactctgaggcggccagggagcag
gtgagccagggggaggagctggcccgggagattgaggccaggtttaacacagtagtgtgt
ggggctggaggggtggtgggaggcctgcacaggatagacctcttccagcccttcctgaag
gaggttgtggagaaacgcaccatagtggaggccacacacatgtacgataatgtagcagag
gcctgcaccactgagagcatgagcccggcccgctgcaattcccccagccccatcaacacc
ctgctagactctgaagaggacgtggagccctcgcctccctatcctgacgttaccctcacc
tcccacctggggggcttcaagctccccgacctggagtccagcgatgccttctcagtcatc
tctgagatcagcaccttcgagagcaagctcaacaacaaggtccccccccaggtgcggccc
aagcccaccatacggaaagtcaacctggggccctacatggaccagcaagggaccaaccgc
cgctccttaccccctgctgtcacctgggcgccgggcagcgacggtggctacgacccctcg
gactacgccgagcccgtggatgccgtgaccaaacagcggcccacagaggaggagagcatc
tactcggtgccccacgacagcactcagggcaagatcatcaccatccgcaacgccaacaag
cattctaacggtggtggcaatggctcagatagcgaggctgacagcagctccctggagcgg
aggcggaagatgtctgctctgggggtgaagccgcggctgtaccgcgaccgctcgaaacgc
ctgggcaagttcagcagcttccgcactagcttctccatcggcagtgacgacgagctgggg
ccgcccaaagcaccagaggagctgggcggggcgcacaaaggggacaactccattaacgag
gagggcgaggaccccaagaggaggaatatcctcagaagcctgcgcagaaacaccaagaaa
ccacggcccaagcccaggcattccatatccaaagtagaaagcaactactttggcgtgccg
ttggccaacgtggtgacacctgaccgacccatcccgctcttcattgacaagtgcatccga
tatattgaggcaacgggtatcactacagaagggatctacagggtgagtgggaacaagtca
gagatggagagcatgcagaggcagtttgaccaggaccataacctggacctggtggagaag
gacttcaccatcaacacggtggccggggccatgaaggccttcttctctgagctgccagaa
cccctggtgccctacagccatcagatcgaactggtggaggccttcaagatcaacgatcgg
gatcagcgagttcacgccatgaaggacatcctgcgccgcttccccagggagaactatgac
gtcttcaaatatgtcatcaatcacttgaacaaggtgagtcagaataaccgtttgaacctg
atgaccagtgagaacctgtccatctgtttctggcccactctgatgcggcctgacttcacc
accatggacgccctgacggccacacgaacctaccagacaatcatcgagtccttcatccac
cagtgtgctttcttcttctacaaccagcccctgtctgacacccctggcgggcacgcctcc
cccacagccaccctctcctcccacgggggaacctcggcctactcctccttggcgtacaac
tctcccaccctcacaccggccccggccccttacgttatgcccgccacgccgccagtcatc
ccacactacgggccgccccatacccagatccagcattccccgccccacacccccctaccc
cccatccaggccctactgccccccctgcacccccaccacccccccacggaacaacacatg
ctgtga

DBGET integrated database retrieval system