KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112228809
Entry
112228809         CDS       T05605                                 

Definition
(RefSeq) bcl2-associated agonist of cell death-like
  KO
K02158  Bcl-2-antagonist of cell death
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04140  Autophagy - animal
otw04210  Apoptosis
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112228809
   04370 VEGF signaling pathway
    112228809
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112228809
  09143 Cell growth and death
   04210 Apoptosis
    112228809
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112228809
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112228809
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112228809
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 112228809
NCBI-ProteinID: XP_024250225
LinkDB
Position
30
AA seq 156 aa
MDHTHDCVDDNPETMNEQDESDHSGTTHYPEFQLHNVSSTRSVRPRPGGRARLYSESQVC
SQVGRRDDTEFQDAITPTEEGGGDGAPFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWL
DKGEPKRGISPGGVKQEVSRGWFSFLWSPNEAEGRE
NT seq 471 nt   +upstreamnt  +downstreamnt
atggaccacacacatgattgtgtggatgacaatccagaaaccatgaatgaacaagacgag
tctgaccactcaggaaccacacactacccagaatttcagctccataatgtctcctctacg
aggagcgtcagaccacgaccaggtgggcgagctcggctctactccgagtcccaggtgtgc
tcccaggttggcagaagggatgacacagagtttcaggatgcaataactcctactgaggag
ggcgggggcgatggggctcctttccgaagccgatcacagtctgctcctcctacactgtgg
gctgcaaagaaatatggccgccagctgaggaggatgagtgatgaatttgacacctggctc
gacaaaggggagcccaagagagggattagcccaggaggggtcaagcaggaggtctcccgg
ggatggttctctttcctctggagtccaaacgaggccgaaggcagggagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112237949
Entry
112237949         CDS       T05605                                 

Definition
(RefSeq) bcl2-associated agonist of cell death-like
  KO
K02158  Bcl-2-antagonist of cell death
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04140  Autophagy - animal
otw04210  Apoptosis
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112237949
   04370 VEGF signaling pathway
    112237949
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112237949
  09143 Cell growth and death
   04210 Apoptosis
    112237949
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112237949
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112237949
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112237949
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 112237949
NCBI-ProteinID: XP_024262314
LinkDB
Position
Unknown
AA seq 161 aa
MAQMFTISDSESEPSEEVGETEKDQSSAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSES
QAQELQGRGPGVEGVPTDGASFRGRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGEMR
RVKSAGAAKQMTKSPSWWAYLFSHKETETEHTPIIPPRSSE
NT seq 486 nt   +upstreamnt  +downstreamnt
atggctcagatgtttactatatcagacagtgagtcagagccctcagaggaggtaggagaa
accgaaaaggaccaatcgtctgccggaaaggggatgactggcggtccaataggccacgcc
ctcactgtgcctgagatgagactggcaggagagggtcggttgaggatgaactcagagtcc
caggcccaggagctccagggtagggggccaggggtggaaggcgtgcccacagacggagca
tctttccggggtcgctcccagtcggccccccctgccctctgggcggccaagagatacggg
cggcagctccgacgcatgagtgacgagttcgatacgtggctggataaaggggagatgagg
cgggtgaagagtgcgggagcagccaaacagatgaccaagtcccccagctggtgggcctac
ctgttcagtcataaggagacagagacagaacatacccctatcatcccaccacgatcatct
gagtag

DBGET integrated database retrieval system