KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112229535
Entry
112229535         CDS       T05605                                 

Definition
(RefSeq) focal adhesion kinase 1-like isoform X1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112229535
   04370 VEGF signaling pathway
    112229535
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112229535
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112229535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112229535
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112229535
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     112229535
Protein kinases [BR:otw01001]
 Non-receptor tyrosine kinases
  FAK family
   112229535
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112229535
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M FERM_F2 Kinase-like
Other DBs
NCBI-GeneID: 112229535
NCBI-ProteinID: XP_024251188
LinkDB
Position
31
AA seq 1140 aa
MEGLYHDISRISYYTEYDRHLAHSKGMATAYLDPNLNHALAGGAKSRLSAGTATERAPGA
PDRVLKVFHHFESNSEHSTWASNIRHGDATDVRGIIQKILDIHKVKCVACFSLRLSHSQS
GQVHWLHPDMGVSHVREKYEQNRSQEEWRYELRIRYLPKGFLHHFSEDKPTLNYFYQQVK
NDYMVEIADQVEQDIALKLGCLEIRRFFREMRGNALDKKSNYELLEKDVGLRRFFPKSLL
DSVKAKTLRKLIQQTFKQFANMNDDQSILKFLEILAPVYRYDKECFKCALGLSWVIQVEL
AIGPEEGISYLTDKGSTPTHLANFTQVQTIGYSVMEDKERKGMLQLNVAGAAEPLTVTTP
SLTTAENMADLIDGYCRLVNGVTQSFIIRPQKEGERALPSIPKVPNNEKRIVEGVVRSAG
VRAISVSDSVNSVTPTPPKPAKARRFLLPFVFCAHDSPPKEDCSGDETDDYAEIIDEDDT
YTMPSTVSYGVDEARDYEIQRDRIELGRCIGEGQFGDVHQGVYNSPENPTLNVAIKTCKN
CTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTMGELRSFLQVRKYNL
DLSTLILFSHQLSTALAYLESKRFVHRDIAARNVLVSSTDCVMLGDFGLSRYMEDSSYYK
ASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMYGIKPFQGVKNNDVIGRIENG
ERLAMPHNCPPTLYSLMTKCWAYDPSKRPRFTELKTQLSTILEEEKAQQEERLRMEMRRQ
VTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHAGQLNHYQVGYPGPHGMPAMPSG
GYPPQAGVLDPHETWNHHRPGDVPMWSPNMEDGGVLDLRGLGQVLPPHLMEERLMMQQQQ
MEEDQRWLEQEECFLKPESRNSRGSIDREDCSLQGPTGNQHIYQPVGLGKPEHVAPPKKP
PRPGAPSHLGSLASLNPVDSYNEGVKPWRIQPQEISPPPTANLDRSNDKVYENVTGLVKA
VIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPVLPASTHREIEMAQKLLNSDL
AELINKMKLAQQYVLTSLQQDYKKQMLTAAHALAVDAKNLLDVIDQARLKMIHAQSRGSH
NT seq 3423 nt   +upstreamnt  +downstreamnt
atggaaggactctatcacgatatttcaagaatttcctactacacagaatatgacagacac
ctagctcacagcaaaggtatggcgacagcttacctggaccccaacctcaaccacgccctg
gctgggggggccaagtcgcgcctcagtgcgggcacggccacggagcgggctcccggggcc
cctgacagggtcctgaaggtcttccatcacttcgagagcaatagcgagcatagcacatgg
gccagcaacatccgccatggggacgccaccgatgtcagggggatcatccagaagattttg
gacatccacaaggtgaaatgcgtggcgtgcttcagcctgcggctcagccactcccaatcc
ggccaggtccactggctccaccctgatatgggcgtgtcccacgtgagggagaaatacgag
cagaaccgctcccaggaggagtggaggtatgaactgcgtattcgctaccttccaaaagga
ttcctgcaccacttcagtgaagataaacccacactcaactacttctaccagcaggtgaaa
aatgactacatggtagagatagccgaccaggtcgagcaagacattgcacttaagttggga
tgccttgaaatcaggagattcttccgggagatgcggggaaatgccctggacaagaaatca
aactatgaactattagaaaaagatgtgggcttaagaagattcttccccaagagtttactg
gattcagtcaaggccaaaaccctgcggaagctgattcagcagacgttcaaacagtttgcc
aacatgaatgatgaccagagcatcctcaagttcctggagattctggcgcccgtttacaga
tatgataaggagtgttttaaatgtgctctcgggttgagctgggtcatccaagtagagcta
gccattggacccgaggagggcattagctaccttacagacaagggttcgactccaacacac
ctggccaacttcacccaggtgcagaccattggatactccgtcatggaggacaaggagagg
aagggcatgctgcagctcaacgtggccggtgctgctgagcctctcacagtgaccacgccg
tcactcaccacagctgaaaacatggccgacctcatagacggctactgtcgcctggtaaac
ggagtcacccagtccttcatcatacggccgcagaaagagggagagagagcactgccttca
atccccaaggtgcccaacaatgagaagaggatagtagagggggtggtccggagcgccggg
gtgcgtgccatctctgtctcagattctgtgaactctgtgaccccgacgcctcctaaacct
gctaaagccaggcgctttctccttcctttcgtcttctgtgcccatgactctccgccaaag
gaggattgtagtggggatgagacggatgactatgctgagattatagacgaagacgatacc
tacaccatgccctcaacagtgagctatggagtagatgaagccagggactatgagatccag
agagacaggatagagctgggacgctgcatcggtgagggacagtttggagacgtccaccag
ggagtctacaacagcccggagaatcccactctaaatgtggccattaaaacatgcaagaac
tgcacgtcggacagcgtgcgcgagaagttccttcaggaagcactgaccatgcgtcagttc
gaccacccccacatagtgaagctgattggtgtgatcacagaaaaccctgtgtggatcatc
atggagctgtgcacgatgggagagttgaggtcatttttacaagtaaggaagtacaacctg
gacctatcaacgttgatcctgttctcccaccagctcagcacagctttggcctacctggag
agcaaacgctttgtccatagggacattgctgccaggaacgtgctagtgtcttccacagac
tgtgtgatgctgggagactttgggctctcacgctacatggaagactcctcctactacaaa
gcttccaaagggaaactgccaatcaaatggatggctccagagtccatcaacttcagacgc
tttacctcagccagcgacgtgtggatgtttggtgtgtgtatgtgggagatcctcatgtac
ggtatcaagcccttccagggggtaaagaacaatgatgtcatcgggcggatagagaacgga
gagcgtctggccatgccccacaactgtccccccaccctgtacagcctgatgaccaagtgc
tgggcctacgaccccagcaagagaccccgcttcacagagctcaaaacccagctcagtact
atcttagaggaggagaaggcccagcaggaggagagactaaggatggagatgagacgtcag
gtcactgtgtcctgggactcagggggctccgacgaggccccccctaaacctagcagacct
ggttaccccagccctcggtctagtgaaggattctaccccagccctcagcacgctgggcag
ctcaaccattaccaggttgggtaccctggcccccacggcatgcccgccatgcccagtggc
gggtaccctccccaggccggtgtcctggacccccatgagacctggaaccaccaccggcca
ggggatgtccccatgtggtcccccaacatggaggatggaggtgtgttggacttgcgtggt
ttgggccaggtgctgcccccacacctgatggaggagaggctgatgatgcagcagcagcag
atggaggaggaccagcgctggttggagcaggaggagtgcttcctgaagccagaatccagg
aactcgcggggcagcattgaccgggaggactgcagtctccaggggccgacgggaaaccaa
cacatataccaaccagtgggactggggaaaccagagcatgtggcccctcctaagaagcct
cctcgtcctggagcccccagccacctgggcagtctggccagcctcaaccctgtagacagc
tacaacgagggggtcaagccctggaggatccaacctcaggagatcagccctccccccacg
gccaacttggaccgctccaacgacaaggtgtatgagaacgtgacaggcctggtcaaggct
gttatagagatgtccagtaagatccagccagcccctccagaggagtacgtcccaatggtc
aaggaggtgggactagctttgagaaccctattggccacagtggacgagaccataccagtg
ttaccagcaagcacacacagagagattgagatggcccagaagctcttgaactctgacctg
gccgagctgatcaacaagatgaagctggcccagcagtatgtcctcaccagcctgcagcag
gactacaagaaacaaatgctgactgctgcacatgccctggctgtggatgccaagaacctg
ctggacgtcatcgaccaggcccggctcaagatgatccatgcccagtcccgggggtcacac
tag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112245979
Entry
112245979         CDS       T05605                                 

Definition
(RefSeq) focal adhesion kinase 1-like
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112245979
   04370 VEGF signaling pathway
    112245979
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112245979
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112245979
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112245979
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112245979
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     112245979
Protein kinases [BR:otw01001]
 Non-receptor tyrosine kinases
  FAK family
   112245979
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112245979
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M FERM_F2 Kinase-like
Other DBs
NCBI-GeneID: 112245979
NCBI-ProteinID: XP_024269997
LinkDB
Position
Unknown
AA seq 1104 aa
MEGLYHDISRISYYTEYDRHLAHSKGMATAYLDPNLNHALAGGAKSRLSAGTGTATERAP
GAPDRVLKVFHHFESNSEHSTWASNIRHGDATDVRGIIQKILDIHKVKCVACFGLRLSHS
QSGQVHWLHPDMGVSHVREKYEQNRSLEEWRYELRIRYLPKGFLHRFSEDKPTLNYFYQQ
VKNDYMVEIADQVEQDIALKLGCLEIRRFFREMRGNALDKKSNYELLEKDVGLRRFFPKS
LLDSVKAKTLRKLIQQTFKQFANMNDDQSILMFLEILAPVYRFDKECFKCALGLSWVIQV
ELAIGPEEGISYLTDKGSTPTHLANFTQVQTIGYSVMEDKEREGMLQLNVTGAAEPLTVT
TPSLTTAENMADLIDGYCRLVSGATQSFIIRPQKEGERALPSIPKVPNNEKKVVEGVVRS
AGVRAISVSEDCSGDETDDYAEIIDEEETYTMPSTVSYGVDEARDYEIQRDRIELGRCIG
EGQFGDVHQGVYNSPENPTLNVAIKTCKNSTSDSVREKFLQEALTMRQFDHPHIVKLIGV
ITENPVWIIMELCTMGELRSFLQVRKYNLDLSTLILFSHQLSTALAYLESKRFVHRDIAA
RNVLVSSTDCVMLGDFGLSRYMEDSSYYKASKGKLPIKWMAPESINFRRFTSASDVWMFG
VCMWEILMYGIKPFQGVKNNDVIGRIENGERLAMPHNCPPTLYSLMTKCWAYDPSKRPRF
TELKTQLSTILEEEKAQQEERLRMEMRRQVTVSWDSGASDEAPPKPSRPGYPSPRSSEGF
YPSPPHAGQLNHYQVGYPGPHGIPAMPSGGYSPQAGVLDPQEAWNHHRPGDVPMWSPNME
DGGALDMRGLGQALPPHLMEERLMIQQQQMKEDQRWLEQEECFLQPESRNSRGSIDREDC
SLQGPTGNIYQPVGLGKSEHVAPPKKPPRPGAPSHLGSLASLNPLESYNEGVKIQPQEIS
PPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDE
TIPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVLTSLQQDYKKQMLTAAHALAVD
AKNLLDVIDQARLKMIHTQSRGSH
NT seq 3315 nt   +upstreamnt  +downstreamnt
atggaaggactatatcacgatatttccagaatttcctactacacagaatatgacagacac
ctagcgcacagcaaaggcatggcgacagcatacctggaccccaacctcaaccacgccctg
gctgggggggccaagtcgcgcctcagcgcgggcacaggcacggccacagagcgagccccc
ggggctccagacagggtcctgaaggtcttccatcacttcgagagcaacagcgagcacagc
acatgggccagtaacatccgccatggggacgccaccgatgtcagggggatcatccagaag
attttggacatccacaaggtgaaatgcgtggcgtgctttggcctgcgtctcagccactcc
cagtccggccaggtccactggctccaccctgatatgggtgtgtcccatgtgagggagaag
tatgagcagaaccgttccctggaggagtggagatatgagctgcgtattcgctaccttcca
aagggattcctgcaccgcttcagtgaagacaaacccacactcaactacttctaccagcag
gtgaaaaatgactacatggtggagatagcggatcaggttgagcaagacattgcacttaag
ttgggatgccttgaaatcaggagattcttccgggagatgcgaggaaatgccctggacaaa
aaatcaaactatgaactattagaaaaagatgtgggcttaagaagattctttcccaagagt
ttactggattcagtcaaggccaaaaccctgcggaagctgatccagcagacattcaaacag
tttgccaacatgaatgatgaccagagcatcctcatgttcctggagattctggcgcccgtc
tacagattcgataaggagtgttttaaatgtgctctcgggttgagctgggtcatccaagta
gagttagccatcggacctgaggagggcattagctaccttacagacaagggctcaactcca
acccacctggccaacttcacccaggtgcagaccattgggtactccgtcatggaggacaag
gagagggaaggcatgctgcagctcaatgtgaccggtgctgctgagcctctcacagtgacc
acgccgtcactcaccacagctgaaaacatggccgacctcatagacggctactgtcgcctg
gtcagcggagccacccagtccttcatcatacggccacagaaagagggagagagagcattg
ccatcaatccctaaggtacctaacaatgagaagaaggtggtagagggggtggtccggagc
gctggggtgcgtgccatctctgtctcagaggattgtagtggggatgagacggacgattat
gctgagattatagacgaagaggaaacctacaccatgccttcaacagtgagctatggagta
gacgaagccagggactatgagatccagagagacaggatagagctgggacgctgcatcgga
gagggacagtttggagacgtccaccagggagtctacaacagcccggagaatcccactctg
aacgtggccattaaaacgtgcaagaactccacatcggacagcgtgcgtgagaagttcctt
caggaagcattgaccatgcgtcagttcgaccacccccacatagtgaagctgatcggtgtg
atcacagagaacccagtgtggatcatcatggagctgtgcacgatgggagagttgaggtcc
tttttacaagtaaggaagtacaacctggacctgtcaacgttgatcctgttctcacaccag
ctcagcacagccttggcctacctggagagcaaacgctttgtccatagggacattgctgcc
aggaacgtgctagtgtcttccacagactgtgtgatgctgggagactttggcctctcgcgt
tacatggaggacagctcctactacaaagcttccaaagggaaacttccaatcaaatggatg
gctccagaatccatcaacttcagacgctttacctcagccagcgatgtgtggatgtttggt
gtgtgcatgtgggagatcctcatgtacggtatcaagcccttccagggcgtgaagaataac
gatgtcatcgggcggatagagaacggagagcgtctggccatgcctcacaactgccccccc
accctgtacagcctgatgaccaaatgctgggcctacgaccccagcaagagaccccgcttc
acagaactcaaaacccagctcagtacaatcctggaggaggagaaggcccagcaggaggag
agactgaggatggagatgagacgtcaggtcactgtgtcctgggactcaggggcctctgac
gaggccccccctaaacccagcagacctggttaccccagccctcggtctagtgaaggattc
taccccagccctccgcatgctggacagctcaaccattaccaggttgggtacccaggccct
catggcattcccgctatgcccagtggagggtactctccccaggccggtgttctggaccct
caggaggcctggaaccaccaccgaccaggagacgtccccatgtggtcccccaacatggag
gacggaggtgcgttggacatgcgtggtctgggccaggcgctgcccccccacctgatggag
gagaggctgatgatacagcagcagcagatgaaggaggaccagcgctggttggagcaggag
gagtgcttcctgcagccagaatccaggaactcgcggggcagcattgacagggaagactgc
agtctccaggggccgacaggaaacatataccaaccagtgggactggggaaatcagagcat
gtggcccctcctaagaagcctcctcgtcctggagcccccagccacctgggcagtctggcc
agcctcaaccctttagaaagctacaacgagggggtcaagatccagcctcaggagatcagc
cctccccccacggccaacttggaccgctccaacgacaaggtgtatgagaacgtgacaggc
ctggtcaaggctgttatagagatgtccagtaagatccagccagcccctccagaggagtac
gtcccaatggtcaaggaggtgggactagcgttgagaaccctattggccacagtggacgag
accataccagtgttaccagcaagcacacacagagagattgagatggcccagaagctgttg
aactctgacctggccgagctgattaacaagatgaagctggcccagcagtacgtcctcacc
agtctgcagcaggactacaagaaacagatgctgacggcggcccacgccctggccgtagac
gccaagaacctgctggacgtcatcgaccaggcccggctcaagatgatccacacccagtcc
cgggggtcacactag

DBGET integrated database retrieval system