KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112229540Help
Entry
112229540         CDS       T05605                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00020  Citrate cycle (TCA cycle)
otw00190  Oxidative phosphorylation
otw01100  Metabolic pathways
otw01200  Carbon metabolism
Module
otw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
otw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
otw_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    112229540
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    112229540
Enzymes [BR:otw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     112229540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 112229540
NCBI-ProteinID: XP_024251195
LinkDB All DBs
Position
31
AA seq 661 aa AA seqDB search
MAALCTASRVLTKKILSAKALPAVSQSSRKLHFSIYGKNEAKVSDGISTQYPVVDHEFDA
VVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEGDDWRWHFY
DTVKGSDWLGDQDAIHYMTEQAPHAVVELENFGMPFSRTEDGKIYQRAFGGQSLKFGKGG
QAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEEGECKGVIALCMEDGSI
HRFRSKNTVIATGGYGRTYFSCTSAHTSTGDGNAMVTRAGLPCQDLEFVQFHPTGIYGAG
CLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSITIEIREGRGCGPEKDHA
YLQLHHLPPQQLATRLPGISETAMVFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLTY
TPEEGDKVVPGLFACGEAACASVHGANRLGANSLLDLVVFGRACAHTIADICNPGEKLSP
LKPNAGEESVANLDKLRFADGSMRTSEIRLNMQKTMQNHAAVFRTGKVLKEGCDKMDAVY
QTLDDVKTFDRGIVWNTDLVETLELQNLMLNAVQTINSAEQREESRGAHSREDFKDRMDE
LDYAKPLAGQVRKPIEEHWRKHTMSTVDPKTGKVTLKYRPVIDNSLDAEDCAAIPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgctgtgtactgcctcccgtgtcctcaccaaaaagatcctgtcagctaaggcg
cttccggcagtatcccaaagctccaggaagctccacttctccatctacgggaagaacgag
gctaaagtgtcagatggcatctccacacagtaccctgtggtagaccatgagtttgatgcc
gtggttgtgggtgccggtggggcaggactacgtgctgcttttggcctgtctgaggctggc
ttcaacacagcttgtgtcacaaagctgttccccaccaggtcgcacacggtggctgcacag
ggcgggatcaatgcagcccttggaaacatggagggagatgattggcggtggcatttctac
gacacagtgaagggatctgattggctgggagaccaggacgccatacactacatgacagag
caggccccacatgccgttgtggagctagagaactttggcatgcccttcagccgaaccgag
gatggcaagatctaccagagggcttttggtggccagagtctgaagtttggcaagggaggc
caggcccaccggtgctgctgcgtagccgatagaaccggccactcccttctgcacacactc
tacggacggtctctgaggtatgacaccagctactttgtggagtattttgccctggacctg
ctgatggaggaaggagagtgtaaaggagtgattgctctgtgtatggaggatggatccatc
caccgcttcaggtccaagaacacagtcattgccacaggtggttacggccgtacctacttc
agctgcacgtcagcccacaccagcacaggagacggtaatgccatggtgacccgtgcaggc
ctgccctgccaagacctggagtttgtccagttccaccccacaggtatctatggagccggc
tgtctgatcacagaggggtgccgtggtgagggaggaatcctcatcaacagtgagggcgag
cgcttcatggaacgatacgcccccaacgccaaggacctggcctccagagacgtcgtgtcc
cgctccattaccattgagatccgagagggcaggggatgtggcccagagaaggaccatgcg
tacctgcagctgcaccatctcccgccacagcagctggccacccgtctgccaggcatctct
gagactgccatggtcttcgccggtgtggatgtcaccaaagagcccatccccgtcctgccc
accgtccactacaacatgggaggaatccccaccaactacaagggacaggtcctcacctac
acacctgaggagggggacaaggtggtgccagggttgtttgcctgtggtgaggctgcctgt
gccagtgtccatggtgccaaccgcctgggagccaactccctgctggatctggtggtgttt
ggacgtgcctgcgcccacacaattgctgacatctgcaatccaggagagaagctctccccc
ctgaagcccaatgcaggagaggagtctgtggccaacctggacaagttgaggtttgctgac
ggcagcatgaggacctccgagatcagactgaacatgcagaagaccatgcagaaccacgcc
gctgtgttccgtaccggcaaggtcctgaaggagggatgtgacaagatggatgctgtctac
cagaccctggacgacgtcaagaccttcgacagaggtattgtgtggaacactgacctggtg
gagaccctggagctgcagaacctcatgctgaacgctgtgcagaccatcaactctgccgag
cagcgcgaggagagcaggggagcccactccagagaggacttcaaggaccgtatggatgag
cttgactatgccaagcctctggcgggacaggtgaggaagcccattgaagagcactggagg
aaacataccatgtccactgtggatcctaagacgggaaaggtaactctgaaatacagaccg
gttattgataactcgcttgatgcagaggactgtgctgctatccctcccgccatccgttcc
tactaa

DBGET integrated database retrieval system