KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112229793
Entry
112229793         CDS       T05605                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta-like isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04141  Protein processing in endoplasmic reticulum
otw04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112229793
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112229793
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112229793
Transcription factors [BR:otw03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    112229793
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA bZIP_Maf CENP-H SlyX
Other DBs
NCBI-GeneID: 112229793
NCBI-ProteinID: XP_024251610
LinkDB
Position
31
AA seq 694 aa
MTTDLLSDLDSRFFADNLLTSEDWDACLYQCESMEEGEDGEYTRRPKYETLFDNDLVLTL
DPDNPTSPWRHLDDNLLTGDSPVLKDKMTITQPLPVDMLFRVKAEPPSPASSLASDCSLT
SLPDSQITVKGENPPTPPYMFGDVLSPPLGTCEVTVASAPQAQPQSHLLPQPQQHQTAAN
NGIDALATVHPTAATIKASTILSSKPPIQPRPVCLSALPIPQSPSPVKALVLHSLPSMDQ
SRPVVLSQSVCLGSTPAIIKMEPVSPTMLHGHSPTAPFPSKPVVQASSLPGSNGIDMKVM
KRQQRMIKNRESACQSRKKKKEYLQNLEGQLREAQQENERLRRENQALRERLVGKEGSES
GNNKRAVCVMAVLLFMTFSFGPVSITDRKLETGLQEDVVTHAGRRLLEFETAQENSRVEE
RMDPEEEEEGGEDGWKGEEVERESTDSYQFRNLSDVFSDVKDLVLQDIDRYFTSNDCRQF
NRSESLRLADELRGWVNRHQIDRKQSGGKPKMVKKAKIAQKALLRKTNFSRYLPIQTHRS
IESQIQVFPAGPKISYSDFMDAIDRREDTFYVVSFRRDHLLLPAISHNKTTRPKMSLVMP
AMSVNESLYNKSHEMMMQVDCEVMDTRIIPIKASDVPPSLRDPPSAPPAHHHHSNHTSLR
GRHHPHTGGAESPRQPLPVRRREAEYYISQGGQV
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgactacggatttactatctgatttggatagtcgtttcttcgctgataaccttctgaca
agcgaagattgggatgcctgtctgtaccagtgcgagagcatggaggagggagaggacggg
gagtacacgagacgaccgaaatatgaaacattgtttgacaacgatctcgtgctgactctt
gatcctgacaatcccacgtcgccatggagacacctggatgacaaccttctcacaggggac
agtcccgtattgaaagataaaatgacgataacgcagcctttgccagtggacatgttgttc
cgggtgaaggcggagcctccctcccctgcctcctcgctggcctcagactgctccctgacg
tcactcccagactcacagatcacagtgaaaggggagaacccgcccacacctccttatatg
tttggagatgtgctgtcgccaccacttggcacatgtgaagtcacggtggcctccgcgcca
caggcccaaccacagtcccatttgctcccacagccacagcaacaccagacagcagccaac
aatggcattgacgcacttgccacagtccaccccactgcggccaccatcaaagccagtacc
atcctgagcagtaagccccccatccagcccaggcctgtgtgtttatcggctctccccatc
ccccagtctcccagtccagtcaaggccctcgtactgcacagcctgcctagcatggaccag
agcaggccagtggtgctttcccagtctgtctgtctggggtccactccagccatcatcaaa
atggagcctgtctctcccaccatgcttcacggccatagccccacagccccattccccagc
aaacccgtagtccaagcgtcctctctgccagggagcaatggcattgatatgaaggtgatg
aagaggcagcagaggatgatcaagaaccgggagtcggcgtgccagtcacgcaagaagaag
aaggagtacctgcagaacctggagggccagctgagggaggcgcagcaggagaacgagcgc
ctccgcagggagaaccaggccctgagggagaggcttgtcgggaaagagggcagtgagtct
ggtaacaataagagggccgtctgcgtcatggcagtgctactgttcatgactttcagtttc
ggccctgtcagtatcacagacaggaagctggagacgggactacaggaagatgtggtgact
cacgcaggaagacgtctcctggagtttgagacggctcaggaaaacagtagagtggaggaa
aggatggatcctgaggaggaggaggagggaggagaggatgggtggaagggagaagaagtg
gagagggaatccaccgattcataccagtttaggaacctgagtgacgtgttcagtgacgtg
aaggatttggtcctgcaggacatcgaccgctatttcacctccaatgactgcaggcagttc
aaccgttccgagtccctcaggctggcggatgagctgagaggatgggttaacaggcaccag
atcgacaggaagcagtctggagggaagccaaagatggtgaaaaaagctaaaatagcgcag
aaagcactgctaaggaagacaaacttctccagatatcttcccatacagacccatcgttcc
atcgagagtcagatacaagtgttccctgccggtcccaagatcagctacagtgacttcatg
gacgccattgaccggcgtgaggacaccttctacgtggtctccttcagacgggatcacctg
ctgttgcctgccatcagccacaacaagaccacacggcccaaaatgtccctggtgatgccg
gctatgtctgtcaacgagagtttatataacaaatcccatgagatgatgatgcaggtggat
tgtgaggtcatggacacccggatcatccccatcaaagcctccgatgttcccccgtccctc
cgcgaccccccttcggctccccccgcccaccatcaccacagcaaccacacctccctccga
ggccgccaccatccccacaccggcggagcggagtctccacggcaacccttacccgtcaga
agacgggaggctgagtattacatcagccaggggggccaggtttga

DBGET integrated database retrieval system