KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112229968
Entry
112229968         CDS       T05605                                 

Definition
(RefSeq) TGF-beta receptor type-2-like isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112229968
   04350 TGF-beta signaling pathway
    112229968
   04068 FoxO signaling pathway
    112229968
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112229968
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112229968
  09143 Cell growth and death
   04218 Cellular senescence
    112229968
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112229968
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112229968
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     112229968
Protein kinases [BR:otw01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   112229968
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal
Other DBs
NCBI-GeneID: 112229968
NCBI-ProteinID: XP_024251906
LinkDB
Position
31
AA seq 548 aa
MELLRFSAFWWGTIMFGSILLEQKMASSMTMLKLKRLCNFCDVESTSCTGTGNCMADCSI
TSICPHPEDVCVSIWRKKDDNVTIDTICHNPAHKLHGLVLEDYNNSKCEMRERNNMGSQF
FICSCSEDECNDHLFFTPYSLDSQVVSVILVSLVPLLVLAVLVITSFYWYRIYHQRRAGA
KRKKTPLDFSDAHAIMMDDDGSDSSSTHANNLNHNTELLPIELDAQVGKGRFAEVYKAKL
KQGATGAGEHFETVAVKIFADEEYASWKNEKDIFSDADLRHENVLHFLTAEDHKVEKQYW
LITAYHPRGNLQEYLTRHVISWDDLWVLGGSLARGVAHLHSDHTLCGRYKVPIVHRDIKS
SNILVKGDLTCVLCDFGLGLRLDNSLSVDELANSGQVGTARYMAPEVLESRINLENIESF
KQTDVYSMALVLWEITSRCNAIGEVKDYEPPFGKVREHPCVESMKDSVLRDRGRPEIPNS
WINHPGIQVVCGTIDECWDHDPEARLTAQCVAERFNDMEHPDKLSGRSNSEEKIPQDVSV
TEIEEIEK
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggagctacttcgtttttccgctttctggtggggaacgataatgtttggtagtattctg
ctagaacagaaaatggcctcatcaatgactatgctgaagctgaagcgtctgtgtaayttc
tgtgacgttgagtctaccagctgtacgggcacagggaactgtatggccgactgtagcatc
acatccatctgcccccatccagaggacgtgtgtgtcagcatctggaggaagaaagacgac
aatgtcaccatagacacgatatgccacaacccagcccataagctgcatggtctggtgctg
gaggactataacaacagcaagtgtgagatgagggagaggaataacatgggctcccagttc
ttcatctgctcctgctccgaggacgagtgcaacgaccaccttttcttcaccccctactcc
ctagactcccaggtggtgtcggtgatcctggtcagcctggttcctctgctggttctggcc
gtgctggtcatcacatccttctattggtaccgcatctaccaccagcgccgcgccggtgcc
aagcgcaagaagacgccgctcgacttcagtgatgcccacgccatcatgatggacgacgac
ggctcggacagcagctccacgcacgccaacaacctcaaccacaacacggagctcctcccc
atcgagctggacgcccaggtgggaaagggccgcttcgccgaggtctacaaggccaagctg
aagcagggcgccacgggggctggcgaacacttcgagaccgttgccgtcaaaattttcgca
gacgaggaatatgcctcgtggaagaacgagaaggacatcttctcggacgccgacctgcgc
cacgagaacgtcctgcacttcctgaccgcagaggaccacaaggtggagaaacagtattgg
ctgatcacggcctaccacccccggggcaacctccaggagtacctgacgcgccacgtcatc
agctgggacgacctgtgggtgctgggcgggtcgctggcaaggggcgtggcccacctacat
agtgaccacacgttgtgtggacgctacaaggtgcccattgtccaccgggacatcaagagc
tccaacatcctggtgaagggggacctcacctgtgtcctgtgtgacttcggactgggtctg
cgtctggacaactcgctgtctgtggacgagctggccaacagtggacaggtgggcactgcc
aggtacatggcccctgaggtgctggagtccagaatcaacctggaaaacattgagtcgttc
aagcagacagacgtttactccatggccctggtactgtgggagatcacctccaggtgcaat
gccattggagaggtgaaggactacgagccgcccttcggtaaggtgagggagcacccgtgt
gtggagagtatgaaggacagtgttctcagagacagagggaggccagagatccccaacagc
tggatcaaccacccaggcatccaggtggtgtgcggcaccatagacgagtgctgggaccac
gaccccgaggccaggctaactgctcagtgtgtggccgaacgcttcaatgacatggagcac
ccagacaagctgtctggacgcagcaattccgaggagaagatcccccaggatgtctctgtg
acggagattgaagagattgagaagtag

DBGET integrated database retrieval system