KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230133
Entry
112230133         CDS       T05605                                 

Gene name
cdkn2d
Definition
(RefSeq) cyclin-dependent kinase 4 inhibitor D
  KO
K06623  cyclin-dependent kinase inhibitor 2D
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112230133 (cdkn2d)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112230133 (cdkn2d)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 112230133
NCBI-ProteinID: XP_024252100
LinkDB
Position
32
AA seq 178 aa
MVLSQSDAAKRLTAAAAKGNTDEVRRMLGXECRVHPDTVNQFGKTALQVMMMGNSNVASL
LLEHGADPNITDRRGVSPAHDAARTGFVDTLRVLVEFGASVNRPDHTGTLPIHIAVREGY
RDVIEFLAPLSNLKHPNTSGETAVDLARASSSCTPDVVELLERQLESKVFSHSPPLPL
NT seq 537 nt   +upstreamnt  +downstreamnt
atggtcctgagtcagagtgatgcggcgaagcgcctgaccgctgccgcagccaagggaaat
acggacgaggtcaggaggatgctagggrcggaatgcagagtgcaccccgatactgtcaat
caatttggaaagaccgctctacaggtgatgatgatgggcaactccaacgtggccagctta
ctgttggagcacggagccgacccaaatatcacagaccggcgaggagtctcaccggcacat
gatgcggcacgcactggcttcgtggacacactccgggttctggtggagttcggcgcgtca
gtcaacaggccagaccacaccggcaccctacccatccacatcgctgtccgagagggctac
cgggacgtcattgagttccttgcacctctctccaacctgaaacaccccaacaccagtgga
gagacagcggtggacctcgcccgagcctcatcgtcatgtacaccggacgtggtagagctt
ttagagagacagctggagtctaaagtgttctctcactccccacctctccctctttag

DBGET integrated database retrieval system