KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230281
Entry
112230281         CDS       T05605                                 

Definition
(RefSeq) growth factor receptor-bound protein 2-like
  KO
K04364  growth factor receptor-bound protein 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04150  mTOR signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112230281
   04012 ErbB signaling pathway
    112230281
   04068 FoxO signaling pathway
    112230281
   04150 mTOR signaling pathway
    112230281
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112230281
   04540 Gap junction
    112230281
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112230281
   04912 GnRH signaling pathway
    112230281
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112230281
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112230281
Membrane trafficking [BR:otw04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    112230281
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   112230281
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_10 SH3_3 hSH3 SH2_2 SH3_4 DUF5093
Other DBs
NCBI-GeneID: 112230281
NCBI-ProteinID: XP_024252280
LinkDB
Position
32
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGETLKVLNEECDQNWYKAELNGKEGFIPKNYIEMKGHPW
FYGKIPRAKAEEMLNKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNSLVDYHRSTSVSRNQPIFLRDIEQVPQHSTYVQALFDFDPQEDGELGFRRG
DFIQVLDNSDPNWWKGACHGQTGMFPRNYVTPVNQNM
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaggccattgccaaatacgatttcaaagccactgcagatgatgagttgagttttaaa
cgtggagaaacgttgaaggttttgaatgaagaatgcgaccagaactggtacaaggcagag
ctgaatgggaaggaaggcttcatccccaagaactacattgaaatgaagggacacccgtgg
ttctatggtaagatcccccgggcgaaggcagaggagatgctgaacaaacaaaggcatgat
ggggccttcctcatccgagagtcggagagcgcaccgggagacttctccctctctgtcaag
tttggtaatgacgtgcagcacttcaaggtcctgcgtgacggggctgggaagtacttcctg
tgggtggtcaagttcaactctctcaactctctggtggactaccaccgttccacctctgtg
tcccgcaaccagcccatcttcctcagggacatcgagcaggtcccacagcattcaacgtac
gtacaggcgctgtttgactttgaccctcaggaggacggcgagctgggcttccgacgcggc
gacttcatccaggtcctggacaactccgaccccaactggtggaaaggcgcttgccacggc
cagacaggcatgttcccgcgcaactacgtcacgccagtcaaccaaaacatgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234492
Entry
112234492         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: growth factor receptor-bound protein 2-like
  KO
K04364  growth factor receptor-bound protein 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04150  mTOR signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112234492
   04012 ErbB signaling pathway
    112234492
   04068 FoxO signaling pathway
    112234492
   04150 mTOR signaling pathway
    112234492
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112234492
   04540 Gap junction
    112234492
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112234492
   04912 GnRH signaling pathway
    112234492
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112234492
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112234492
Membrane trafficking [BR:otw04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    112234492
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   112234492
SSDB
Motif
Pfam: SH3_1 SH3_9 SH2 SH3_2 SH3_10 SH3_3 SH2_2 SH3_4 hSH3 DUF5093
Other DBs
NCBI-GeneID: 112234492
NCBI-ProteinID: XP_024258413
LinkDB
Position
Unknown
AA seq 216 aa
MEAIAKYDFKATADDELSFKRGEVLKVLNEECDQNWYKAELNGKDGFIPKNYIEMKAHPW
FFGKIPRKAEEMLNKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLW
VVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQHPTYVQALFDFDPQEDGELGFRRGD
FIQVLDNSDPNWWKGGCHGLTGMFPRNYVTPVNRNM
NT seq 651 nt   +upstreamnt  +downstreamnt
atggaggccattgccaaatacgatttcaaagccactgctgacgacgagttaagttttaaa
cgtggggaagttctaaaggtattaaatgaagagtgtgaccagaactggtacaaagcagaa
ttgaacgggaaagacggcttcatccccaagaactacatagagatgaaagcacatccgtgg
ttctttggcaagatcccccgtaaagcagaggagatgttgaacaaacagaggcacgacggg
gccttcctcatccgagagagtgagagtgcgccaggggacttctccctctctgtcaagttt
ggaaatgacgttcagcacttcaaagtcctgcgtgatggggcaggaaagtacttcctgtgg
gtggtgaagttcaactcgctcaacgagctggtggactaccaccgctccacctctgtatcc
cgcaaccagcagatcttcctgcgtgacattgagcaggtcccccagcatcccacatatgta
caggcgctctttgactttgacccccaggaggatggcgagctgggcttccgacgcggagac
ttcatccaggtcctggacaactctgaccctaactggtggaagggaggatgccatgggctg
acgggcatgttcccccgcaactatgtcacaccagtcaaccggaacatgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234604
Entry
112234604         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: growth factor receptor-bound protein 2-like
  KO
K04364  growth factor receptor-bound protein 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04150  mTOR signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112234604
   04012 ErbB signaling pathway
    112234604
   04068 FoxO signaling pathway
    112234604
   04150 mTOR signaling pathway
    112234604
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112234604
   04540 Gap junction
    112234604
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112234604
   04912 GnRH signaling pathway
    112234604
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112234604
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112234604
Membrane trafficking [BR:otw04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    112234604
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   112234604
SSDB
Motif
Pfam: SH3_1 SH3_9 SH2 SH3_2 SH3_10 SH3_3 SH2_2 SH3_4 hSH3 DUF5093
Other DBs
NCBI-GeneID: 112234604
NCBI-ProteinID: XP_024258582
LinkDB
Position
Unknown
AA seq 216 aa
MEAIAKYDFKATADDELSFKRGEVLKVLNEECDQNWYKAELNGKDGFIPKNYIEMKAHPW
FFGKIPRKAEEMLNKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLW
VVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQHPTYVQALFDFDPQEDGELGFRRGD
FIQVLDNSDPNWWKGGCHGLTGMFPRNYVTPVNRNM
NT seq 651 nt   +upstreamnt  +downstreamnt
atggaggccattgccaaatacgatttcaaagccactgctgacgacgagttaagttttaaa
cgtggggaagttctaaaggtattaaatgaagagtgtgaccagaactggtacaaagcagaa
ttgaacgggaaagacggcttcatccccaagaactacatagagatgaaagcacatccgtgg
ttctttggcaagatcccccgtaaagcagaggagatgttgaacaaacagaggcacgacggg
gccttcctcatccgagagagtgagagtgcgccaggggacttctccctctctgtcaagttt
ggaaatgacgttcagcacttcaaagtcctgcgtgatggggcaggaaagtacttcctgtgg
gtggtgaagttcaactcgctcaacgagctggtggactaccaccgctccacctctgtatcc
cgcaaccagcagatcttcctgcgtgacattgagcaggtcccccagcatcccacatatgta
caggcgctctttgactttgacccccaggaggatggcgagctgggcttccgacgcggagac
ttcatccaggtcctggacaactctgaccctaactggtggaagggaggatgccatgggctg
acgggcatgttcccccgcaactatgtcacaccagtcaaccggaacatgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112264096
Entry
112264096         CDS       T05605                                 

Definition
(RefSeq) growth factor receptor-bound protein 2-like
  KO
K04364  growth factor receptor-bound protein 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04150  mTOR signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112264096
   04012 ErbB signaling pathway
    112264096
   04068 FoxO signaling pathway
    112264096
   04150 mTOR signaling pathway
    112264096
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112264096
   04540 Gap junction
    112264096
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112264096
   04912 GnRH signaling pathway
    112264096
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112264096
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112264096
Membrane trafficking [BR:otw04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    112264096
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   112264096
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_10 SH3_3 hSH3 SH2_2 SH3_4 DUF5093
Other DBs
NCBI-GeneID: 112264096
NCBI-ProteinID: XP_024296462
LinkDB
Position
2
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGETLKVLNEECDQNWYKAELNGKEGFIPKNYIEMKGHPW
FYGKIPRAKAEEMLNKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNSLVDYHRSTSVSRNQPIFLRDIEQVPQHSTYVQALFDFDPQEDGELGFRRG
DFIQVLDNSDPNWWKGACHGQTGMFPRNYVTPVNQNM
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaggccattgccaaatacgatttcaaagccactgcagatgatgagttgagttttaaa
cgtggagagacgttgaaggttttgaatgaagaatgcgaccagaactggtacaaggcagag
ctgaatgggaaagaaggcttcatccccaaaaactacatagaaatgaagggacacccgtgg
ttctatggtaagatcccccgggcgaaggcagaggagatgctgaacaaacagaggcacgat
ggggccttcctcatccgagagtcggagagcgcaccgggagacttctccctctctgtcaag
tttggtaatgacgtgcagcacttcaaggtcctgcgtgacggggctgggaagtacttcctg
tgggtggtcaagttcaactctctcaactccctggtggactaccaccgttccacctctgtg
tcccgcaaccagcccatcttcctcagggacatcgagcaggtcccacagcattcaacgtac
gtgcaggcgctgtttgacttcgatcctcaggaggacggcgagctgggtttccgacgcggc
gacttcatccaggtcctggacaactccgaccccaactggtggaaaggggcttgccacggc
cagacgggcatgttcccgcgcaactacgtcacgccagtcaaccaaaacatgtga

DBGET integrated database retrieval system