KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230347
Entry
112230347         CDS       T05605                                 

Definition
(RefSeq) protein kinase C alpha type-like
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04150  mTOR signaling pathway
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04912  GnRH signaling pathway
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112230347
   04012 ErbB signaling pathway
    112230347
   04310 Wnt signaling pathway
    112230347
   04370 VEGF signaling pathway
    112230347
   04020 Calcium signaling pathway
    112230347
   04070 Phosphatidylinositol signaling system
    112230347
   04150 mTOR signaling pathway
    112230347
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112230347
   04540 Gap junction
    112230347
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112230347
   04916 Melanogenesis
    112230347
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112230347
   04270 Vascular smooth muscle contraction
    112230347
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112230347
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112230347
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     112230347
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   112230347
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112230347
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like
Other DBs
NCBI-GeneID: 112230347
NCBI-ProteinID: XP_024252367
LinkDB
Position
32
AA seq 673 aa
MADVTQFNEGTGDFAKGFARKGALRQKNVHEVKDHKFTARFFKQPTFCSHCTDFIWGFGK
QGFQCQVCCFVVHKRCHEFVTFCCPGADKGPDTDDPRTKHKFKIHTYGSPTFCDHCGSLL
YGLIHQGMKCDTCDMNVHNQCVMNVPSMCGTDHTERRGRLYLKCEVTEDKLQVTVGEGRN
LIPMDPNGSSDPYVKLKLIPDPKNETKKKTKTILANLNPTWNESFTFKLKATDKDRRLSV
EVWDWDRTTRNDFMGSLSFGVSELIKSPVCGWYKMLNQEEGEFYNVPISEEDDGNEELRQ
KFEKAKLGPGTKKVISPSDDSPSSLPSNNLDSVKLTDFNFLAVLGKGSFGKVILAEMKPT
EELYAVKILKKDVVIQDDDVECTMIEKRVLAQQDKPPFLTSLHSCFQTVDRLYFVMEYVT
GGDLMYHIQQVGKFKEPQAVFYAAEISVGLSFLHKKGVIYRDLKLDNVMLDSEGHIKIAD
FGMCKENIHEGVTTRTFCGTPDYIAPEIIAYQPYGLSVDWWAYGVLLYEMLAGQPPFDGE
DEDELFQSIMEHNVSYPKQMSKEAVSICKGLMTKHPSKRLGCGSEGERDIQEHAFFRRID
WERLQNREIQPPFKPKGCGKGAENFDKFFTRTQPQLTPPDQLVIANIDQADFSGFSFINP
QFVHPSLVSLHTV
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgatgttacgcaattcaacgaggggaccggggacttcgcgaaagggtttgctcgt
aaaggagcgttgaggcagaagaacgtccatgaagtgaaggaccacaaattcactgcgagg
ttcttcaagcagccgactttttgtagccactgcaccgactttatctggggatttggaaag
caaggattccagtgccaagtttgctgtttcgtggtccacaagaggtgccatgagtttgtc
acgttctgctgccccggggcggataagggtcccgacacagacgaccccagaaccaagcac
aagttcaagatccacacctacggcagccccaccttctgcgaccactgtggctctctcctg
tacggtctcatccaccaggggatgaagtgcgacacctgcgacatgaacgtgcacaatcag
tgtgtgatgaacgtgcccagcatgtgtgggacggaccacaccgagaggaggggacgcctc
tacctgaagtgtgaggtcacagaggacaagctgcaggtcacagtgggcgaaggtcgaaat
ctgatccccatggaccccaacggctcgtctgatccttacgtcaagctcaagctcatccca
gatcccaagaatgagaccaagaagaagaccaagaccatcctcgccaacctcaatcccacc
tggaatgagtcttttacattcaagctgaaggctacagataaggaccgcaggctgtctgtg
gaggtgtgggactgggaccgtacyaccaggaacgacttcatgggctccctgtccttcggc
gtgtcagagctgatcaaatctcctgtgtgtggctggtacaagatgttgaaccaagaggag
ggcgagttctacaacgtgcccatctcagaggaggatgacgggaacgaggagctccgacag
aagtttgagaaagccaagctgggccctggtaccaagaaggtgatctctccatcagatgac
agcccgtctagtctgccctctaacaacctggactcggtcaaactcaccgacttcaacttc
ctggccgtgctggggaaaggcagcttcggcaaggtgatcctggcagagatgaagcccacg
gaggagctgtacgccgtcaagatcctgaagaaggacgtggtgattcaggacgatgatgtg
gagtgtaccatgatcgagaagagagtcctggcccagcaggacaaaccacccttcctcact
tcactccactcctgtttccagaccgtggaccggctgtactttgtcatggagtacgtgact
ggaggagacctcatgtaccacatccaacaagtgggcaagttcaaagagccacaggcggtg
ttctacgcagcagagatctctgtcggcctgtccttcctgcacaagaaaggagtcatttac
agggatctgaagctggacaacgtgatgctggactcggagggccacattaagatcgctgac
tttggcatgtgtaaagagaacatacacgagggcgtgaccactcgcaccttctgtgggacg
cccgactacatcgccccagagattattgcatatcagccatatgggctatcagtggattgg
tgggcatacggagtgctgctctacgaaatgttggcaggacagcccccgtttgatggtgag
gacgaggacgagctcttccagtccataatggagcacaacgtgtcgtaccccaagcaaatg
tccaaagaggccgtgtccatctgcaaagggctgatgaccaaacacccgtcgaagcgtctg
ggctgtggctccgagggagagagggacatccaggagcacgccttcttcagacgcatcgac
tgggaacgcctccagaaccgcgagatccagccccccttcaagcccaaagggtgcggcaaa
ggggcggagaacttcgacaagttcttcacacgcacccagccccagctcacgccccccgac
cagctggtcatcgccaacatcgaccaagccgacttctcaggcttctccttcatcaacccc
cagtttgtgcacccctccctggtctccctgcacaccgtatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265049
Entry
112265049         CDS       T05605                                 

Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04150  mTOR signaling pathway
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04912  GnRH signaling pathway
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112265049
   04012 ErbB signaling pathway
    112265049
   04310 Wnt signaling pathway
    112265049
   04370 VEGF signaling pathway
    112265049
   04020 Calcium signaling pathway
    112265049
   04070 Phosphatidylinositol signaling system
    112265049
   04150 mTOR signaling pathway
    112265049
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112265049
   04540 Gap junction
    112265049
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112265049
   04916 Melanogenesis
    112265049
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112265049
   04270 Vascular smooth muscle contraction
    112265049
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112265049
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112265049
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     112265049
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   112265049
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112265049
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like APH
Other DBs
NCBI-GeneID: 112265049
NCBI-ProteinID: XP_024297828
LinkDB
Position
2
AA seq 682 aa
MADVTQFNEGTGDFAKGFARKGALRQKNVHEVKDHKFTARFFKQPTFCSHCTDFIWGFGK
QGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRTKHKFKIHTYGSPTFCDHCGSLL
YGLIHQGMKCDTCDMNVHNQCVMNVPSMCGTDHTERRGRLYLKCDITGDKLQVTVGEGRN
LIPMDPNGSSDPYVKLKLIPDPKNETKKKTKTIRANLNPTWNESFIFKLKPTDKDRRLSV
EVWDWDRTTRNDFMGSLSFGVSELIKSPVCGWYKMLNQEEGEYYNVPISEEDDGNEELRQ
KFEAKDKANQVQKAKLGPGTKKVIAPSDDSRSNLPSNNLDSVKLTDFNFLAVLGKGSFGK
VILAEMKPTEELYAIKILKKDVVIQDDDVECTMIEKRVLAQQDKPPFLTSLHSCFQTVDR
LYFVMEYVNGGDLMYHIQQAGKFKEPQAVFYAAEISVGLFFLHKKGIIYRDLKLDNVMLD
SEGHIKIADFGMCKENIYEGVTTRTFCGTPDYIAPEIIAYQPYGLSVDWWAYGVLLYEML
AGQPPFDGEDEDELFQSIMEHNVSYPKQMSKEAVSICKGLMTKHPSKRLGCGSEGERDIR
EHAFFRRIDWERLQNREIQPPFKPKGCGKGAENFDKFFTRTQPQLTPPDQLVIANIDQAD
FSGFSFINPQFMHPSLVSLHTV
NT seq 2049 nt   +upstreamnt  +downstreamnt
atggctgatgtcacgcaattcaacgaggggaccggggacttcgcgaaagggttcgctcgt
aaaggagctttgaggcagaagaatgtccatgaagtgaaggaccacaaattcactgcaagg
ttcttcaagcagccgactttttgtagtcactgcaccgactttatctggggatttggaaag
caaggattccagtgccaagtttgctgtttcgtggtccacaagaggtgccatgagtttgtc
acgttctcttgccccggtgcggataagggtcccgacacagacgaccccagaaccaagcac
aagtttaagatccacacctatggcagccccaccttctgcgaccactgtggctctctcctg
tatggtctcatccaccaggggatgaagtgtgacacctgcgacatgaacgtgcacaatcag
tgtgtgatgaacgtgcccagcatgtgcgggacggaccacaccgagaggaggggacgcctc
tacctgaagtgtgacatcacaggggacaagctgcaggtcacagtgggcgaagggcgaaat
ctgatccccatggaccccaacggctcgtctgacccttacgtcaagctcaagctcatccca
gaccccaagaatgagaccaagaagaagaccaagaccatccgcgccaacctcaaccccacc
tggaatgagtctttcatattcaagctgaagcctacagacaaggaccgcaggctgtctgtg
gaggtgtgggactgggaccggaccaccaggaacgacttcatgggctccctgtccttcggc
gtgtcagagctgatcaaatcgcctgtgtgtggctggtacaagatgttgaaccaagaggag
ggcgagtactacaacgtgcccatctcagaggaggatgacggaaacgaggagctccgacag
aagtttgaggcaaaggacaaagccaaccaagttcagaaagccaagctgggccctggtact
aagaaggtaatcgctccatcagatgacagcaggtccaatctgccctctaacaacctggac
tcggtcaaactcaccgacttcaacttcctggccgtgctggggaaaggcagcttcggcaag
gtgattctggcagagatgaagcccacagaggagctgtacgccatcaagatcctgaagaag
gacgtggtgatccaagatgatgatgtggagtgtaccatgatagagaagagagtcctggcc
cagcaggacaaaccacccttcctcacctcactccactcctgcttccagaccgtggaccgg
ctgtactttgtcatggagtatgtgaatgggggagacctcatgtaccacatccaacaagcg
ggcaagttcaaagagccacaggcggtgttctatgcagcagagatctctgttggcctgttc
ttcctgcacaagaaaggaatcatttacagggatctgaagctggacaatgtgatgctggac
tcggagggccacattaagatcgctgattttggcatgtgtaaagagaacatatacgaggga
gtgaccactcgcaccttctgtgggacgcccgactacatcgccccagagattattgcatac
cagccatacgggctatcagtggattggtgggcatatggagtgctgctctacgaaatgttg
gcaggacagcccccatttgatggtgaggacgaggacgagctcttccaatccatcatggag
cacaacgtgtcgtaccccaagcaaatgtccaaagaggccgtgtccatctgcaaagggctg
atgaccaaacacccgtcgaagcgtctgggctgcggctccgagggagagagggacatccgg
gagcacgccttcttcagacgcatcgattgggaacgtctccagaaccgcgagatccaaccc
cccttcaagcccaaagggtgcggcaaaggggcggagaacttcgacaagttcttcacgcgc
acccagccccagctcacgccccccgaccagctggtcatcgccaacatcgaccaagctgac
ttctcaggcttctccttcatcaacccccagttcatgcacccctccctggtctccctgcac
accgtatga

DBGET integrated database retrieval system