KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230419
Entry
112230419         CDS       T05605                                 

Definition
(RefSeq) son of sevenless homolog 1-like isoform X1
  KO
K03099  son of sevenless
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04150  mTOR signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112230419
   04012 ErbB signaling pathway
    112230419
   04068 FoxO signaling pathway
    112230419
   04150 mTOR signaling pathway
    112230419
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112230419
   04540 Gap junction
    112230419
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112230419
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112230419
   04912 GnRH signaling pathway
    112230419
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112230419
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   112230419
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH Herpes_UL92 PH_10 IQ_SEC7_PH PH_19
Other DBs
NCBI-GeneID: 112230419
NCBI-ProteinID: XP_024252488
LinkDB
Position
32
AA seq 1370 aa
MQAAQVQYDFFSEENAPKWRGLLVPSLNKVLSQVHPKLSSQEDALQYIEELILLLLSMLC
QAQPRSVQDVEERVQKSFPHPIDKWAIADAQAAIEKRKRRNPLALPVDKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLAGNYVRNIRHYEISQQDITVAMCADKVLMDMFHQDE
EDISGFPLMDEEPSTSEEQTYYDLVKTFMAEVRQYLRDLNLIIKVFREPIASDAKLFSHH
DVENIFSRIVDIHEVTLKLLGLIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYETYAQ
DILRTGFHDHFLNQLSKPGAAFYLQSICEGFKEAVQYVLPRLLLTPVYHCLHYFEILKQL
EEKSEDEEDKECLKQAITALLNLQSSMERICSKNMAKRRLSESACRFYSQQMKGKHLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGKLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASSTAEYRLKEKFLMRKVQINDKDDKEGEYRHAFEIILKDGNSVVFAAKSAEDKNGWM
AALISLQYRSTLERMLDSAMLQEEKEEQMRLPGAELYRFATPDSEENVVFEENVQSKSGI
PIIKAGTVLKLIERLTFHMYADPNFVRTFLTTYRSFCKPQELLGLLMERFEIPEPKPTEA
DQMAIENGDQPLSAELKRFRKEFVQPVQLRVLNVCRHWVEHHFYDFERDCQLLKCLEEFI
ALVRGKAMKKWVESITKIIQRKKQAQANGPSHNITFESSPPPIEWHLSKSGQTDQFDLMT
LHPIEIARQLTLLESDFYRAVQPSELVGSVWTKEDKELNSPNLLRMIRHTTNLTLWFEKC
IVETENLEERAAVVARIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQR
KILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPDFLKRHGKELINF
SKRRKVAEITGEIQQYQNQPYCLRVESDIRKFFENLNPMEDKAEKEFADYLFNKSLEIEP
RNARSLPRYVGRRPSALYGRNAPAIKPKKYNCPLKSPGVRPSSVRPGTMRHPTPLQNEPR
KISYSRIPDSEMESAASAPNSPRTPLTPPPASAASSSTDIGSVFDSPQGPSSPFHSNCDS
IFAQVSLPHGPRSSSVSSMVSFHRNTEDTTVPPPVPPRRRPESAPAESSPSKMMSKHLDS
PPAIPPRQPTTTKVYSPRYSLSTERTSVSEPPDSPPTLPPREPVRTPDVFSSSNSPLHLQ
PPPLGRIRSSEPTLSQTFFPPSPFSPLTPPPPPTPSPSLGPSGPDCCSDSALLPLGGAAG
PPVPPRQSTSSAAAQAIPKLPPKTYKRELVSHPSLVHRDGPPLLENANPS
NT seq 4113 nt   +upstreamnt  +downstreamnt
atgcaagcggcccaggttcagtacgactttttcagcgaggagaacgcaccgaaatggcgg
gggctgttggtaccctccctgaacaaggtgctgagtcaggtgcatcccaagctgtcgtcc
caggaggatgcgctgcagtacatcgaggagctgatcttgctgctgctcagcatgctctgc
caggcacagccacgcagcgtgcaggacgtggaggagcgagtgcagaagagtttccctcac
cctatcgataaatgggctatcgctgatgcccaggcggccattgaaaagaggaagaggagg
aatcctttggccttgcccgtggataagatccacccgctgctcaaggaggtactaggttac
aagattgaccaccaggtgtcggtgtacattgtggcagtgttggagtacatctcagcagac
atcctgaagctggcagggaactacgtgaggaacatccgccactacgagatctcccagcag
gacatcaccgtggccatgtgtgccgataaggttctgatggacatgttccaccaggatgag
gaggacatcagcggtttccccctgatggacgaggagccgtccaccagcgaggagcagacc
tactacgacctggtcaagaccttcatggcagaggtccgacagtacctgcgcgacctcaac
ctcatcatcaaggtgttccgcgagccaatcgcctccgacgccaagctcttctcccaccat
gatgtggagaacatcttcagccgcatcgtggacatccacgaggtcaccctcaagctgctg
ggcctcattgaagacacggtggagatgacagatgaggggagcccacacccgctggtgggc
agctgcttcgaagacctggccgaggagctggccttcgacccctacgagacatatgctcaa
gacatcctgcggactggcttccacgatcacttcctcaaccagttgtctaaaccgggagct
gccttctacctccagtctatatgcgaaggctttaaggaagcagtccagtacgtcctgccc
cggttgctcctcacaccggtctatcattgtctccactatttcgagatcttaaagcaacta
gaggagaaaagtgaggacgaggaggacaaggagtgtctgaagcaggccatcacggcgctg
ctcaatctgcagagtagcatggagaggatctgctccaagaacatggccaagaggaggctg
agcgagtcagcctgccgcttctacagccagcagatgaagggcaagcacctggccatcaag
aagatgaacgagatccagaagaacattgacggctgggagggcaaggacattggccagtgc
tgcaacgaattcatcatggaggggaagctgacacgcgtgggcgccaagcacgaacggcac
atattcctcttcgacggcctgatgatctgctgcaagtccaaccacggccagccgcgcttg
cctggcgcctcgtccaccgccgagtaccgcctcaaggagaagttcttaatgcgcaaggtg
cagatcaatgacaaggacgacaaggagggcgagtaccggcacgcctttgagatcatcctc
aaagatggcaacagcgtggtgttcgccgccaagtcggccgaggacaagaatggctggatg
gcggcgctcatctcactgcagtaccgctcgacgctggagcgcatgctggactcggccatg
ctacaggaggagaaggaggagcaaatgaggctgcccggggcggagctttaccggttcgcc
acgcccgactctgaggagaacgtggtgttygaggagaacgtgcagtccaagtcgggcatc
cccatcatcaaggcgggtacagtgctcaagctcatcgaaaggctcaccttccacatgtat
gcagatccaaatttcgtccgaacatttctaacaacctacaggtccttctgtaaacctcag
gagctgctgggtcttcttatggagaggtttgaaattcccgagccaaagcccacggaggcg
gaccagatggccatagagaacggagaccaacctctcagcgccgaacttaaacgatttcgc
aaggagtttgtccagccagtccaactcagggtattgaatgtatgtcgccactgggtggag
caccacttctatgactttgagcgggactgtcagttactcaagtgtctggaggagttcatt
gcattggtgcgaggcaaggccatgaagaagtgggtggagtccattaccaagatcatccag
aggaagaagcaagcacaggccaatgggcccagccacaacattaccttcgagagctcgcca
ccgcccatcgagtggcacctcagcaagtcgggtcagacagaccagtttgacctcatgacc
ctccaccccattgagatcgcccggcagctcacactgctcgagtccgacttctacagggca
gtgcagccgtcagagctggtgggcagcgtgtggacgaaggaggacaaggagctgaactcg
cccaaccttctgcgcatgatccgccacaccaccaacctcacgttgtggttcgaaaagtgt
atcgtagagacggagaacctggaagagcgggcagcggtggtggcgcgtatcatcgagatc
ctgcaggtgttccaggagctcaacaacttcaacggcgtgctggaggtggtcagcgccatg
aactcctcgcccgtctaccggctagaccacaccttcgagcaaattccaagccgacagagg
aagattctggaggaggcccacgaactgagcgaggaccactacaagaagtacctggcaaaa
ctgcgctccatcaaccccccctgtgtccccttctttgggatctacttgacgaacatcctg
aagacggaggaaggcaaccctgacttcctgaagaggcatggcaaggagctgatcaacttc
agcaagcgacggaaagtggcggagatcaccggggagatccagcagtaccagaaccagccc
tactgcttacgggtggagagcgatatccggaagttctttgaaaacctcaatccaatggag
gacaaggcagagaaggagtttgctgactatctgttcaacaagtcgctggagattgagcct
cggaatgcccggtcgttgcctcgatatgtggggcggcgtccgagcgccctctatggacgc
aacgcccctgctattaagcccaagaagtacaactgcccgctcaagtcccctggcgtgcgc
ccgtcctcggtgcgcccgggcaccatgcgacatccgacgccactgcagaatgagccgcgc
aagatcagctacagccgcatccctgatagcgagatggagagcgccgcctctgcacccaac
tcgccgcgcacgcccctcacgccgccgccggcctcggctgcctccagctccacagatatc
ggcagcgtgttcgactcaccccagggcccctccagccccttccactccaactgcgacagc
atctttgcccaggtctccttaccacacggcccacggtcttcctcggtttcctccatggtg
agtttccacaggaacactgaagacaccaccgtccccccgcctgtgccccctcgcagacgc
cccgaatccgcccccgctgaatcttccccttcgaagatgatgtcaaagcacttggacagc
ccccccgccatccccccacggcagcccaccaccaccaaggtctactcacctcgctactcg
ctctcgaccgagcgcacctctgtgtcagagccacctgacagcccacccaccctgccgccg
cgggagcccgtgagaacgccggacgtcttctccagctcaaacagccccctgcacctgcag
ccacccccgctgggccgcatccgcagcagcgaacccacgctgagccagaccttcttccca
ccctcgccgttcagcccactcaccccgccgccgcccccaactccctcaccctcgctgggg
cccagcggcccagactgctgcagcgactcagccctcctccctctggggggtgcagctggc
ccccctgtgccccctcgccagagcaccagcagtgccgctgcccaagctatccccaagctc
cctcccaaaacatacaaaagggagttggtgtcacacccgtccctagtgcatcgggatggc
ccacccctactggagaatgccaacccctcttaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112262240
Entry
112262240         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: son of sevenless homolog 2-like
  KO
K03099  son of sevenless
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04150  mTOR signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112262240
   04012 ErbB signaling pathway
    112262240
   04068 FoxO signaling pathway
    112262240
   04150 mTOR signaling pathway
    112262240
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112262240
   04540 Gap junction
    112262240
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112262240
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112262240
   04912 GnRH signaling pathway
    112262240
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112262240
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   112262240
SSDB
Motif
Pfam: RasGEF RasGEF_N Histone RhoGEF PH
Other DBs
NCBI-GeneID: 112262240
NCBI-ProteinID: XP_024293702
LinkDB
Position
11
AA seq 1261 aa
MQPQQIYDFSSDENSHKWRGLFVQALRKVQLQVHPTLSAKEGALEHIEELILQLLNMLCV
AQPRSVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPLLKEVLGYK
IDYHVCLYIVAVLEYISADILKLAGNYVGNIRHYEISQQDIKVSMCADKVLMDMFDQDED
IGLVSQCTEEPSSSGELTYDDLVRLEIAEERQYLRELDLIIKVFRHHFLFNNKIFTPQDV
EVIFSNILDIPELTVKLLGLIEQDAXEMTADGSPPFWWAALASRDLAEEQAFDPYETLSQ
DILSRQFHEHFSSLMARPTVGLYFQSIAEVSRRRVQYVCHSSWMVPVTTVLHYFELLQQL
QEHSEEQDDREGLKQAITALLNLQCSVERIYTKHLPRRKPGEPMYRLYSRQVRSKQLAIK
RMNEIQKSIDGWEGKDIGQCCSEFILEGALLRAGAKHERHNFLFDGLMISCKANQSSRLP
GSGSGAEFRLKEKFVLRKVRIVDREDSAEFKHAFELVGKDENCVVFCARSAEEKGSWMAA
LVTLQYRSTLDRMLDTVLQHEEQAQPLRLPSPELYRFAVHDSEENIVFEDRVQSKTGIPI
IKAGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPHELLGLLIDRIEIPEPEPTEADK
QALWNGDQPMAAELQRFRREYVQPVQLRVLNVFRQWVEHHFYDFENDPELRGRLEEYISS
IIQLRGKSMRKWVESINKIIKRKMQTQSNGVSHNITFESPPPPIEWHISRLGQTDTFDLM
TLHPIEIARQLTLLESELYRAVRPSELVGSVWTKEDKENNSPNLLRMIRHTTNLTLWFEK
CIVEAENLDERVAVFTRVIEILQVFQELNNFNGVLEVVSAINSVPVYRLDHTFEAVPERK
KRILEEAVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRHGKELIN
FSKRRKVAEITGEIQQYQNQPYCLKVQQDTRRPSVLNPPLYLSRPARKSLVPLKVPGSGR
RGPSQRTLKATPYRERRPPTKTAPCHLNRISVLWSKILCNSYGDHSVSCGSLHQLGEDLL
KPPPLPPRRKDAFSETKARSDSPPAIPPRLPLHSQDPPRAPVYNSPSDGPLSSPPTTTPA
RPQPDTPPPVPRDPRDLHNYPLNXSPSPVGRFHWXFGSSPSPPAQPPGTPLPSPRPRRSC
PPSASQNSLCPPLPSLPPVPPRHNSNSSPQLPKLPPKTYKRELLPPPLQSLSLVENTDTS
Q
NT seq 3786 nt   +upstreamnt  +downstreamnt
atgcagccgcagcaaatatatgacttttcaagtgacgagaacagtcacaaatggcgaggc
ctcttcgtgcaagcgttgcgaaaggtgcagctgcaggtgcatcccaccctgtcagccaag
gagggagctctggagcacatcgaagagctgatcctgcagctcctcaacatgctgtgtgtg
gcccagccgcgctctgtacaggacgtggaggagcgtgtccagaagactttcccccacccc
atagataaatgggccatagctgacgcccagtcagccatcgagaagaggaagaggaggaac
cccctactgctccccgtggataagatacaccctctactcaaggaggtgctgggttataag
atagactaccacgtctgcctctacatcgtggcggttctagagtacatatcagctgacatc
ctgaagctagcaggaaactacgttggtaacatcagacactatgagatcagccagcaagac
atcaaggtgtccatgtgtgcagacaaggtcctaatggacatgtttgaccaggacgaggac
atcggtctggtgtctcagtgtacggaggagccttcgtcgtccggagagctgacctacgac
gacctggtgcgcctggagattgcagaggagcgccagtacctgcgggagctcgacctcatc
atcaaggtgttccgacatcacttcctgttcaacaacaagatctttacgcctcaggatgtg
gaggttattttcagtaacatcttggacatccctgagttgacggtcaagctgctgggcctg
atcgagcaagatgcangtgagatgaccgctgacggtagtccacccttctggtgggcagct
ctggcttcgagggacctggcagaggagcaggcgtttgacccgtacgagaccctgtctcag
gacatcctgtccaggcagttccacgagcacttcagcagtctgatggcccggcctactgta
ggactatacttccagtccatagctgaagtttcaaggaggcgggtacagtacgtctgccac
agctcatggatggttcctgttaccactgtgttgcactactttgaactgctgcagcagctg
caggagcacagtgaggagcaggatgaccgagagggtctgaagcaggccatcaccgctctg
ctcaacctccagtgtagcgtggaacgcatctacaccaaacacctgccccgacgcaagcct
ggcgagcccatgtaccgtctgtacagccgtcaggtgcgcagcaagcagctggccatcaag
aggatgaacgagatccagaagagcatcgacggctgggaggggaaggacatcggccagtgc
tgttccgagttcatcctggagggggcgctcctccgcgccggcgccaaacacgagcgacac
aacttcctgttcgacggcctcatgatcagctgcaaggccaatcagagctcccgactcccc
ggttctggaagtggggccgagttccgtctcaaggagaagttcgtcctgcggaaagttcgc
atcgtggaccgcgaggactcggcggagttcaaacacgccttcgaactcgtcggtaaagac
gagaactgtgtggtgttctgcgcccgctcggcggaggagaaagggtcttggatggcggcg
ctggtcactctgcagtaccgctccacgctggaccgtatgttggacacggttctgcagcac
gaggagcaggcccagcccctccgcctgccctcccccgagctttaccgtttcgctgtgcac
gactcagaggagaacatcgtgtttgaagatcgcgtccagagcaagacggggatacccatt
attaaagcaggcacggtggtcaagcttatagagaggctcacctaccacatgtatgctgat
cccaactttgtgcgcacttttctgaccacctaccggtccttctgcaagccccacgagctc
ctcggcctcctgatagacaggattgagatcccagagccggagcccaccgaggcagacaag
caggcgctatggaacggagatcagccaatggctgcagagctacagaggttccggagggag
tacgtccaacccgtccaactccgggtcctgaatgttttccgtcagtgggtggaacatcat
ttctatgactttgagaacgaccctgagctacgaggcagactggaggagtacatcagcagc
attattcagctacgaggcaagtctatgaggaagtgggtggagtctatcaacaagatcatc
aagaggaagatgcagactcagtccaacggggtcagccacaacatcaccttcgagagcccg
cccccgcccatcgagtggcacatcagccgcctgggtcagacggacacctttgacctcatg
acccttcaccccatagagatcgcccgccagctcaccctgttggagtcagaactatacagg
gctgtgaggccatctgagctggtggggagtgtctggaccaaagaggacaaggagaataac
tctcccaacctactgagaatgatccgccacaccaccaacctcacactgtggtttgagaag
tgtattgtggaagcagagaacctggatgagagggtagcagtgttcacccgggtcattgag
atcctccaggtgtttcaggagctcaacaatttcaacggtgttctggaggtggtctccgcc
atcaactctgtccctgtctaccggctcgatcacacctttgaggcggtccccgagaggaag
aagaggatcctagaggaagcagtggaactgagccaggaccatttcaagaagtacctggcc
aagctcaagtccattaacccgccctgtgtgcctttctttggtatctacctgaccaacatc
ctgaagacagaggaggggaaccccgacttcctgaagagacacggcaaagagctgatcaac
ttcagtaagaggaggaaagtagcagaaatcacaggagagatacagcagtaccagaaccag
ccgtactgtctcaaggtgcagcaggacacaaggaggccatcagtcctcaaccctcctctg
tacctctctcgcccagccaggaagtcccttgtacccctgaaagtcccggggtccggccgg
cgtggtcccagtcagcggaccctgaaggccaccccctaccgggagaggagaccccccact
aagactgcaccctgccacctcaaccgcatctctgtcttatggagcaagatcctctgcaac
tcctacggagatcattcagtttcttgtggaagccttcaccagctaggagaggacttactc
aaaccccctccacttccccctcgcaggaaggatgctttctctgagaccaaggccaggtct
gacagtcctccagccatcccgcccaggctgcccctccactcccaggatccgccccgcgcc
ccggtctacaatagccccagcgacggccccctctccagcccccccaccaccacacccgcc
cggccccagcccgacacccctccacctgtccccagagaccccagagatcttcacaactac
cccctgaacnnttcaccctcccctgtcggacgcttccactggnactttggcagctcccct
tcacccccggcacaacccccgggcacccctctcccgtccccgcgcccccgacgaagctgc
ccccccagcgctagtcagaacagtctctgccctccgctgcccagtctgccccctgtgccc
cctcgccacaactccaactcctccccccagctccccaaactccccccaaagacctacaag
agggagctgttgccgcccccgttacagagcctctcattggtggagaacacggacactagc
caatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265983
Entry
112265983         CDS       T05605                                 

Gene name
sos1
Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04150  mTOR signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112265983 (sos1)
   04012 ErbB signaling pathway
    112265983 (sos1)
   04068 FoxO signaling pathway
    112265983 (sos1)
   04150 mTOR signaling pathway
    112265983 (sos1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112265983 (sos1)
   04540 Gap junction
    112265983 (sos1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112265983 (sos1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112265983 (sos1)
   04912 GnRH signaling pathway
    112265983 (sos1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112265983 (sos1)
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   112265983 (sos1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH Herpes_UL92 PH_10 IQ_SEC7_PH PH_19
Other DBs
NCBI-GeneID: 112265983
NCBI-ProteinID: XP_024299264
LinkDB
Position
2
AA seq 1396 aa
MQAAQVQYDFFSEENAPKWRGLLVPSLNKVLSQVHPKLSSQEDALQYIEELILLLLSMLC
QAQPRSVQDVEITFGSRKTVSRPSLLESLMESTTNCGEERVQKSFPHPIDKWAIADAQAA
IEKRKRRNPLALPVDKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADILKLAGNYVRNIR
HYEISQQDITVAMCADKVLMDMFHQDEEDISGFPLMDEEPSTSEEQTYYDLVKTFMAEVR
QYLRDLNLIIKVFREPIASDAKLFSHHDVENIFSRIVDIHEVTLKLLGLIEDTVEMTDEG
SPHPLVGSCFEDLAEELAFDPYETYAQDILRTGFHDHFLSQLSKPGAAFYLQSICEGFKE
AVQYVLPRLLLTPVYHCLHYFEILKQLEEKSEDEEDKECLKQAITALLNLQSSMERICSK
NMAKRRLSESACRFYSQQMKGKHLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRV
GAKHERHIFLFDGLMICCKSNHGQPRLPGASSTAEYRLKEKFFMRKVQINDKDDKEGEYR
HAFEIILKDGNSVVFAAKSAEDKNGWMAALISLQYRSTLERMLDSAMLQEEKEEQMRLPG
AELYRFATPDSEENVVFEENVQSKSGIPIIKAGTVLKLIERLTFHMYADPNFVRTFLTTY
RSFCKPQELLGLLMERFEIPEPKPTEADQMAIENGDQPLSAELKRFRKEFVQPVQLRVLN
VCRHWVEHHFYDFERDCQLLKRLEEFIALVRGKAMKKWVESITKIIQRKKQAQANGPSHN
ITFETSPPPIEWHLSKPGQTDQFDLMTLHPIEIARQLTLLESDFYRAVQPSELVGSVWTK
EDKELNSPNLLRMIRHTTNLTLWFEKCIVETENLEERAAVVARIIEILQVFQELNNFNGV
LEVVSAMNSSPVYRLDHTFEQIPSRQRKILEEAHELSEDHYKKYLAKLRSINPPCVPFFG
IYLTNILKTEEGNPDFLKRHGKELINFSKRRKVAEITGEIQQYQNQPYCLRVESDIRKFF
ENLNPMEDKAEKEFADYLFNKSLEIEPRNARSLPRFVGRRPSALYGRNAPAIKPKKYNCP
LKSPGVRPSSVRPGTMRHPTPLQNEPRKISYSRIPDSEMESAASAPNSPRTPLTPPPASA
ASSSTDIGSVFDSPQGPSSPFHSRSSSVSSMVSLHRSTEDATVPPPVPPRRRPESAPAES
SPSKMMSKHLDSPPAIPPRQPTTTKVYSPRYSLSTERTSLSEPPDSPPTLPPREPVRTPD
VFSSSNSPLHLQPPPQGRIRSSEPTLSQTFFPPSPFGPLTPPPPPTPSPSLGPRKHLPSP
PLPLLGPGGPDCCGDSALLPPGGAAGPPVPPRQSTSSAAAQAIPKLPPKTYKRESVSYPS
LAHRDGPPLLENANPF
NT seq 4191 nt   +upstreamnt  +downstreamnt
atgcaagcggcccaggttcagtacgactttttcagcgaggagaacgcaccgaaatggcgg
gggctattggtaccctccctgaacaaggtgctgagccaggtacatcccaaattgtcatcc
caggaggatgcactgcagtacattgaggagctgatcctactgctgctcagcatgctctgc
caggcacagccacgcagcgtgcaggacgtggagatcacgtttggaagcagaaaaacagtg
agcagaccttcccttttggagtccctcatggaatcaacaacgaactgtggcgaggagcga
gtgcagaagagtttccctcaccctatcgataagtgggctatcgccgacgcgcaggcagcc
atcgaaaagaggaagaggaggaatcctttggccctgccagtggataagatccacccgctg
ctcaaggaggtactagggtacaagattgaccaccaggtgtcggtgtacatcgtggccgtg
ttggagtacatctcagcagacatcctgaagctggcagggaactacgtgaggaacatccgc
cactacgagatctcccagcaggacatcaccgtggccatgtgtgccgataaggttctgatg
gacatgttccaccaggatgaggaggacatcagcggtttccccctgatggacgaggagccg
tccaccagcgaggagcagacctactacgacctggtcaagaccttcatggcagaggtccga
cagtacctgcgcgacctcaacctcatcatcaaggtgttccgcgagccaatcgcctccgac
gccaagctcttctcccaccatgatgtggagaacatcttcagccgcatcgtggacatccac
gaggtcaccctcaagctgctgggcctcattgaagacacggtggagatgacagatgagggg
agcccacacccgctggtgggcagctgcttcgaagacctggccgaggagctggccttcgac
ccctatgagacgtatgctcaagacatcctacggactggcttccacgatcacttcctcagc
cagctgtctaaaccgggagctgccttctacctccagtctatatgcgaaggctttaaggaa
gcagtccagtacgtcctgccccggttactcctgacacctgtctatcattgtctccactat
tttgagatcttaaagcaactggaggagaaaagtgaggacgaggaggacaaggagtgtctg
aagcaggccatcacggcgctgctcaatctgcagagtagcatggagaggatctgctccaag
aacatggccaagaggaggctgagcgagtcggcctgccgcttctacagccagcagatgaag
ggcaagcacctggccatcaagaagatgaacgagatccagaagaacattgatggctgggag
ggcaaggacatcggccagtgctgcaacgagttcatcatggaggggacactgacacgcgtg
ggcgccaaacacgaacggcacatcttcctcttcgacggcctgatgatctgctgcaagtcc
aaccatggccagccgcgcttgcctggcgcctcgtccaccgctgagtaccgcctcaaggag
aagttcttcatgcgcaaggtgcagatcaacgacaaggacgacaaggagggcgagtaccgg
cacgcctttgagatcatcctcaaagacggcaacagcgtggtgttcgccgccaagtcagcc
gaggacaagaatggctggatggcggcgctcatctcgctgcagtaccgctcgacgttggag
cgcatgctggactcggccatgctgcaggaggagaaggaggagcaaatgaggctgcccggg
gcggagctttaccggttcgccacgcccgactctgaggagaacgtggtgttcgaggagaac
gtgcagtccaagtcgggcatccctatcatcaaggcggggacagtgctcaagctcatcgaa
aggctcaccttccacatgtatgcagatccaaattttgtccgaacatttctaacaacctac
aggtccttctgcaaacctcaggagctgctgggtcttcttatggagaggtttgaaatccca
gagccaaagcccacagaggcagaccagatggccatagaaaacggagaccaacctctcagc
gccgaactcaaacgatttcgcaaggagtttgtccagccagtccaactccgagtactgaat
gtatgtcgccactgggtggagcaccacttctatgactttgagcgggactgccagttactg
aagcgtctggaggagttcattgcattggtgcgaggcaaggccatgaagaagtgggtggag
tccatcaccaagatcatccagaggaagaagcaggcgcaggccaacgggcccagccacaac
atcaccttcgagacctcgccgccacccatcgagtggcacctcagtaagccgggccagaca
gaccagtttgacctcatgaccctccaccccattgagatcgcccggcagctcacactgctc
gaatccgacttctacagggcggtgcagccatcagagctggtgggcagcgtgtggacgaag
gaggacaaggagctgaactctcccaaccttctgcgcatgatccgccacaccaccaacctc
acgttgtggttcgaaaagtgtatcgtagagacggagaacctggaagagcgggcagcggtg
gtggcgcgtatcatcgagatcctgcaggtgttccaggagctcaacaacttcaatggcgtg
ctggaggtggtcagcgccatgaactcttcgcctgtctaccggctagaccacaccttcgag
caaattccaagccgacagcggaagattctggaggaggcccacgaactgagcgaggaccac
tacaagaagtacctggcaaaactacgctccatcaaccccccctgtgtccccttctttggg
atctacttgacgaacatcctgaagacggaggaaggcaaccctgacttcctgaagaggcat
ggcaaggagctgatcaacttcagcaagcgacggaaagtggccgagatcaccggggagatc
cagcagtaccagaaccagccctactgcttacgggtggagagcgatatccggaagttcttt
gaaaacctcaatccaatggaggacaaggcagagaaggagtttgctgactatctgttcaac
aagtcgctggagatcgagcctcggaatgcccggtcgttgcctcgatttgtggggcggcgt
ccgagcgccctctatggacgcaacgcccctgctattaagcccaagaagtacaactgcccg
ctcaagtcgcccggcgtgcgcccgtcctcggtgcgcccgggcaccatgcgccacccgacg
ccactgcagaacgagccacgcaagatcagctacagccgcatccctgacagcgagatggag
agcgccgcctctgcgcccaactcgccgcgcacgcccctcacgccgccgccggcctcggcc
gcctccagctccacggacatcggcagcgtgttcgactcgccccagggcccctccagcccc
ttccactccaggtcctcttcagtttcctccatggtgagtctccacaggagcactgaagac
gccaccgtccccccgcctgtgccccctcgcagacgccccgaatccgcccccgctgaatct
tccccttcgaagatgatgtccaagcacttggacagcccccccgccatccctccgcggcag
cccaccaccaccaaggtctactcgccgcgctactcgctctcgaccgagcgcacctccttg
tcggagccgcctgacagcccacccacactgccaccgcgggagcccgtgagaacgccggac
gtcttctccagctccaacagccccctgcacctgcagccacccccgcagggccgcatccgc
agcagcgaacccacgctgagccagaccttcttccctccctcgccgttcggcccgctcacc
ccgccaccacccccgactccctcgccctcgctggggccgcgcaagcacctgccctccccg
cccttaccactgctggggcccggcggcccagactgctgcggcgactcagccctactccct
ccggggggtgcagctggcccccctgtgcccccccgccagagcaccagcagcgctgctgcc
caagccatccccaagctcccccccaaaacgtacaaaagggagtcggtgtcatacccgtcc
cttgcgcatcgagacggcccgcccctgctggagaatgccaaccccttttaa

DBGET integrated database retrieval system