KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230757
Entry
112230757         CDS       T05605                                 

Definition
(RefSeq) rap guanine nucleotide exchange factor 1-like isoform X1
  KO
K06277  Rap guanine nucleotide exchange factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112230757
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112230757
SSDB
Motif
Pfam: RasGEF RasGEF_N
Other DBs
NCBI-GeneID: 112230757
NCBI-ProteinID: XP_024252792
LinkDB
Position
33
AA seq 1217 aa
MSGKIESKQDSQRSHLSSFTMKLKDRFHSPKIKRTPSKKGKQLQVEPAVKSQEKPVNKKV
SRLEEQEKEVVSALRYFKTIVDKIMVEKKVLEMLPGSASKVLEAILPLVQVEARITHSSA
VSSCHNRVYQSLANLIRWSDQVMLDDIDLDDKDNVVAVTTVIKAVLDGVKELVKLTIEKQ
EQPSPTTLNKPLPPIATPESTSELPLTEREREILSKTTPTVPPTEAMTNMAEEDIAPPKP
PLPSLKMDALRAHLATDHFVAAQRRSTKTDTPPPALPPKKRQSAPSPTRVAVVSPMSRGS
SLPCSVHRRQQDYEQEFLQRRFSGGSQSYRGNSPRLSPCSSIGKLSKSDEHLCSMEQDSG
RCSQNTSCETLDNTESYDPDYDFLHQDLSVFTGDPLAPSGVTSLSPLPESHSESSSPVPP
PTALAPHAPHPHHSEYWTPQPGSHISPLHPCRLSAPPALPQKKRRSAQVSPYPDGCWGGS
SRGPLYERFPSQYDNLSEEELLHPTPPFPLFTPISPMPQSNGGVFVAQYLASENADVPSS
PPPLPEKRNKHVLAYMQFVEDYSEPQPSVFYQTPQSESIYEQRNKRFQDVYGLNDSFSST
DSVHEPLPVPLFPPPALPPKQRQLASHSSAPCSSSSSSLPCHLHPSLVAAAEEVGSGLGL
SLSVSSSSCLSGHSSLTMPMSSDQVALVNATLLAGSGDGPDCSLANLLGSVAVCLPSSET
TSLLTDSLLHTSAVSVDEGGEGEYVNLYASSQANGELPLCLREPNSADDVLEDPSPQMPS
SNSKEALDKDRRQKSTDSAPCDEEVDELSLIDHKEIMSRITLKQENDDGPDVRAGSGDIL
LVHATETERKDLVLYCEAFLTTYRTFISPEDLIKKLHYRYTRFCHSPDTFKKRVSKNTFF
VLVRVVDELCLVELTEDILKQLMDLVFRLVCNGELSLARVLRKNILDKVEQKKLLRCTNS
LKPLAARGVSARPGTLHDFRSHEIADQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLT
QFTEHFNNMSYWVRSLIIQQEKGQDREKLLLKFIKIMKHLRKLNNFNSYLAILSALDSAP
IRRLEWQKQTSEGLEEYCTLIDSSSSFRAYRAALADVEPPCIPYLGLILQDLTFVHLGNP
DLIDGKVNFSKRWQQFNILDSMRRFQQVHYELKRNDDIVCFFNDFSDHLAEEALWELSLK
IKPRNITRRRTEREEKT
NT seq 3654 nt   +upstreamnt  +downstreamnt
atgtcggggaaaatagagagcaagcaagactcgcagcgctcccacctttcctccttcacc
atgaagctgaaggacaggttccactctccaaagatcaagaggaccccatcgaagaagggc
aagcagctgcaggtcgagccagccgtcaagagccaagagaaacctgtcaacaagaaggtg
agtcggctggaggagcaggagaaggaggtggtgagcgctctgcgttacttcaagaccata
gtagacaagattatggtggagaagaaggtgctggagatgttgcctggctcggccagcaag
gtcctggaggccattctacccctggtgcaggtagaggcccggataacacacagttcggcg
gtgtcgtcgtgtcacaaccgtgtgtaccagagcctggccaacctgatccgctggtccgac
caggtcatgctggatgacatcgacctggacgacaaggacaacgtggtcgcggtcaccacc
gttatcaaggctgtgctagacggggtcaaggaactggtcaaactcaccatagagaaacag
gagcagccctcacccaccactctcaacaaaccactaccacctattgccacacctgagagc
acatccgagttgcccctgacggaacgggagcgggagatcctgagtaagaccacgcccact
gtcccgcccaccgaggctatgacgaacatggcagaggaggacatagccccgcccaaaccc
cccctccctagcctgaagatggatgcgctcagagcacacttggctactgaccactttgta
gctgcccaaaggagatccacaaagactgacactcctcctccagccctgcccccaaagaag
cgccagtcggccccgtcgcccacccgggtggcagtggtgagccccatgagccgtggctcc
agcctgccctgcagcgtccatagacggcagcaggactatgagcaggagttcctccagagg
cgtttctcaggcggtagccagtcgtacaggggcaactccccgcgcctctcgccctgcagc
agcataggaaagctcagcaagtctgacgagcatctctgctccatggaacaggacagcgga
cggtgctcccaaaatactagttgtgagacgctggacaacacggagagttatgacccggac
tatgacttcctccaccaggacctctcagtcttcactggggaccccctcgccccctcaggg
gtcacctctctgtcgcccctccctgagtcccacagcgagtcatcctcccccgtccctcct
cccaccgctttagctccacacgccccccaccctcaccactccgaatactggaccccccag
cccggttctcacatcagccccttgcacccttgccgcctcagcgcgcctccagcgttaccc
cagaagaagcggcgcagcgcccaggtgtcgccctatccggacgggtgctggggtggttcc
tcgcgggggcccctctacgagaggttcccctcgcagtacgataacctgtcggaagaggag
ctgctgcaccccacaccccccttccccctcttcacgcccatctcacccatgccccagagc
aacgggggcgtgtttgtggctcagtacctggccagcgagaatgcagacgttccctctagt
ccaccgccgctgcccgagaagaggaacaagcacgtcctggcgtacatgcagtttgtggag
gactactcggagccccagccctccgtgttctaccagacgccgcagagcgagagcatctac
gagcagaggaacaagcgcttccaggacgtctacggcctcaatgactccttcagcagcacc
gactcggtccacgagcccctgcccgtacccctcttcccgcctcccgccttgccccccaag
cagaggcagctggcctcccactcttccgccccctgttcttcctcatcctcctctctgccg
tgccacctccacccttcattggtggcggcagcagaggaggtgggctctggcctggggctc
agcctatcggtctctagctcctcctgccttagtggacactcctcgctgaccatgcccatg
agctcggaccaggtcgccttggtcaatgccaccctattggctggcagcggggatgggccc
gactgttccctggccaacctattgggctctgtggccgtctgtcttccttcctctgagacc
acttctcttctcactgactctctcctccacacctcggcagtgagtgtggacgagggtggc
gagggtgagtatgtcaacctgtacgcatccagccaggccaacggggagctgccactctgc
ctcagagagcccaactctgctgacgacgtccttgaagacccctctccacagatgccctct
tccaatagcaaggaggctctggacaaggacaggaggcagaagtcaacagactctgcgcct
tgcgacgaggaagtggatgagctctctctcattgaccacaaagagatcatgtccaggatt
acactaaaacaagagaatgatgatggtcctgacgtgcgtgctggatcaggggatattctg
ttagtccacgccacagagacggaacgcaaagatctggtgttgtactgtgaagccttcctg
accacatacaggacattcattagcccagaggacctcattaagaagctgcactacagatat
accaggttctgtcacagtccagacacatttaagaagcgggtcagcaagaacacgttcttt
gtgctggttcgagtggtggatgagctgtgtctggtggagttgacggaggacatcctgaag
cagctgatggacctggtgttcaggctggtgtgtaacggcgagctgagcctggcccgcgtg
ctccgcaagaacatcctggacaaggtggagcagaagaagctgctacgctgcaccaactct
ctcaagccgctggccgcccggggcgtgtccgccaggcccggaacgctgcatgacttccgc
agccatgagattgccgatcagctcacactactggatgcagaactgttctacaaaattgag
attcctgaggtgttgctttgggccaaggagcagaatgaggagaagagtccaaatctgact
cagttcacagagcactttaacaacatgagctactgggtgcgctctctaatcattcagcag
gagaaaggccaggaccgagaaaagctgctcctcaagttcatcaagatcatgaagcactta
cggaagttgaacaatttcaactcatacttggcaatactgtctgccctggactcggccccc
atccgcaggctagagtggcagaaacagacctcagagggattggaggaatactgtacgttg
attgacagctcgtcgtctttcagagcgtaccgggcggctctggccgacgtggagcctccg
tgcatcccataccttggtttgatcctgcaggacctgaccttcgtccacctggggaacccg
gacctcatcgacgggaaggtcaacttctccaagcgctggcagcagttcaacatcctggac
agtatgaggcgcttccagcaagtgcattacgagctgaagcgcaatgacgacatagtctgc
ttcttcaacgacttcagcgaccatctggccgaggaggcattgtgggaactctcactgaag
atcaagcctcgcaacatcacccggcggcggacggagcgcgaggagaagacttag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112247636
Entry
112247636         CDS       T05605                                 

Definition
(RefSeq) rap guanine nucleotide exchange factor 1-like isoform X1
  KO
K06277  Rap guanine nucleotide exchange factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112247636
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112247636
SSDB
Motif
Pfam: RasGEF RasGEF_N
Other DBs
NCBI-GeneID: 112247636
NCBI-ProteinID: XP_024272216
LinkDB
Position
4
AA seq 1118 aa
MSGKIESKPDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKVSKPPLEHGVKTAEKPANKSL
SRLEEQEKDVVSALRYFKTIIDKMAVDKKVLEMLPGSASKVLEAILPLVQVDARIQHSSV
VSSCLNRVYQSLGNLIRWSDQVMLEGVNLEDKETIVTVTTVIKAVLDGVKELVKLTIEKQ
EHPSPTSPVKPVPVATPPESAAEPPANEKESLDKSSATSQSMEALTEPTGEEEEEEEEVV
APPKPPLPGLKMAEHNPPALPPKKRQSAPSPTRVAVVAPMSRATSGSSLPMSIGLHKQEY
EVDALQRRFSGGSHYYGGESPRISPCNSMGKLSKSDGQLSWTMDSGQCSRNTSSEALDTT
DHYDPDYDFLHQDLSSLEQMTPVPVGACLSPLPESHSESSCPGPGPPLAQLHFSSLQGCS
VTSALPPPALPEKKRRGGACSGFSDGSYSGSSWCVSFERHPSQYDNLMEEDLPPVPPFPL
FTPDILPLCHTAGGFVSEFSGSETTDVPQSPPPLPEKKSRHILKYMQFVEDYSEPQPSVF
YQMPQSKSIYEQRNKHFQEVYGFNDSFSSSDSVHEPLPPPALPPKQRQLSMDLAAPGSGS
PDPVLVANGSLDSSLAIGLLTDSSFSDTRQTSLSESANEEGGEGEYVNLYTSSQANGDGL
SRRDSSAIDDSLEDTASENPLCNNKDMSDDRRRQKSSEDGQSSEETDELSLIDHMEIMSR
LTLKQENDDGPDVRAGSGDILLVHATETDRKDLVLYCEAFLTTYRTFITPEDLIKKLHYR
YTRFCHCPDTFKKKVSKNTFFVLVRVVDELCLVEMTEDILMQLMDLVFRLVCNGELSLAR
VLRTNILDKVEQRKLLRYTYSLKPLAARGVAARPGTLHDFRSHEIADQLTLLDAELFYKI
EIPEVLLWAKEQNEEKSANLTQFTEHFNNMSYWVRSIIILQEKAQDREKLLLKFIKIMKH
LRKLNNFNSYLAILSALDSAPIRRLEWQKTTSEGLEEYCTLIDSSSSFRVYRAALADVEP
PCIPYLGLILQDLTFVHLGNPDQINGKVNFSKRWQQFNILDSMRRFQQVHYDLKHNDDIV
SFFNDFSDHLAEEALWELSLKIKPRNITRRKTEREEKT
NT seq 3357 nt   +upstreamnt  +downstreamnt
atgtcggggaaaatagagagtaaaccagactcccaacgctcccatttgtcttccttcacc
atgaagcttatggacaagttccactctcccaaaatcaaaaggacaccctcgaagaaagtc
agtaagccgcctttagaacatggcgttaagactgcggagaaacctgctaacaagagtctg
agtcggttagaggagcaagagaaagacgtggtcagtgccttgcgttacttcaagaccatc
attgacaagatggcggtggacaagaaggtgctggagatgttaccaggctctgccagtaag
gtcctggaggccatcctgcctttagtccaagtggacgcaaggatccagcacagctcggtg
gtgtcctcctgtctgaaccgtgtgtaccagagtctgggcaatctcatccgttggtctgac
caagtcatgctggagggggtcaacctggaagataaagaaaccatcgttaccgtcaccact
gtgatcaaggcagtgcttgatggtgttaaggagctagtgaaactgaccatagagaaacag
gagcatccttcccccacgtctcctgtcaaaccagtgccagtggccaccccacccgagagt
gctgctgagccgcctgccaatgagaaggagagtctggacaagagctcagccacgtcccaa
tctatggaagccctgactgaacccactggagaggaggaggaggaggaggaggaggtggtg
gccccaccaaaaccccctctccctggcctcaagatggctgaacacaatcctcctgctctg
cctccaaagaagcgccagtctgccccctcacccacccgggtggcagtagtggcccccatg
agccgcgccaccagtggctccagtcttcccatgagcatcggcctccacaaacaggagtac
gaggtggatgccctgcagaggcgcttctctgggggcagccattactacggaggggagtcg
ccgcgcatatccccctgcaatagcatgggcaagctgagcaagtccgacgggcagctgtcc
tggacaatggacagtgggcagtgctcacgcaacaccagcagtgaggctctggacaccaca
gaccactacgacccggactacgacttcctgcaccaggacctgtccagcttggagcagatg
actcctgtgccagtgggagcgtgcctcagccccctgcctgagtcccacagcgagtcttcc
tgccctggccccggtccgccgctggcacaactccacttcagctccctccagggctgctcc
gtgacttccgccctgccgccccctgccctgccagaaaagaagcgcagaggtggcgcctgc
tcaggcttttccgacggctcctactcgggctcatcctggtgcgtttcctttgagcgccac
ccatcccagtacgacaacctcatggaggaggacctaccgcctgtgcccccctttcccctg
ttcacgcccgacatcttgcccctgtgccacaccgccggggggtttgtgtctgagttcagc
ggcagcgagacaacagatgtacctcagagtccaccgccactccctgagaagaagagccgt
cacatactgaagtacatgcagtttgtggaagactactcagagccccagccctcagttttc
taccagatgccacagagcaagagcatctatgagcaacgcaacaagcacttccaggaagtc
tacggcttcaatgactcgtttagcagcagcgactctgtccacgagcccctcccacccccg
gcactgccacccaaacagaggcagctgagcatggacctagcggccccgggcagtggcagc
cccgaccctgtgctggtggccaacggctctctggacagctctcttgctatcggtcttctc
actgactcttctttctctgacactcgtcaaacctctttgagcgaaagcgctaacgaggaa
ggcggggagggagagtacgttaatctgtacacatccagccaagccaacggagatgggctc
tcccgccgagactcgtctgccatagatgactcactggaggacactgcctcggagaaccca
ctgtgcaataacaaggacatgtccgatgaccgccgaagacaaaagtcgtctgaagatggg
cagagtagcgaggagacggatgagctttccctcatcgatcacatggagatcatgtcccgg
ttaacactaaagcaggagaacgatgacggtccagatgtccgagccggatcgggggatatt
ttattagtccacgccacagaaacggaccgcaaagatcttgtcttgtactgtgaggctttc
ctgacgacgtacagaacgttcataaccccagaggaccttatcaaaaagctgcactacaga
tacaccaggttttgtcactgcccagataccttcaagaagaaagtcagcaaaaacaccttc
tttgttcttgtccgtgtggtggacgagctgtgtctggtggagatgacggaggacatcctg
atgcagctgatggacttggtgttcaggctggtgtgtaacggtgagctgagcctggcccgc
gtcctccgcacaaacatcctggacaaggtggagcagaggaagctgctgcgctacacctac
tcgctcaaaccactggccgcaagaggtgtcgccgccagacctgggaccctgcacgacttc
cgaagtcatgagatcgccgaccagctaactctcctggatgcagagctcttctacaaaatt
gagatccctgaggtgttgctttgggctaaggagcagaacgaggagaagagtgccaacctc
acacagttcacagagcactttaacaacatgtcctactgggtacgctccataatcattctg
caagagaaagcccaggaccgagaaaagctcctcctcaaatttatcaaaataatgaagcac
ttacggaagctaaataatttcaactcatatttggcaatattatctgccttggattcagct
cccatccgaagactggagtggcagaaaacaacctcagagggcctagaggaatactgcacg
ttaatagacagctcctcgtcgttccgggtctaccgagcggcactggcagatgtggagccc
ccatgtataccatatctgggtcttatcctccaggacttgacctttgtccatctgggcaac
cctgatcaaatcaacgggaaggtcaacttctccaagcgctggcagcagttcaacatcctg
gacagcatgaggcgcttccagcaggtgcattatgatctgaaacacaacgacgatattgtc
tccttcttcaacgacttcagcgaccacctggcagaggaggctctgtgggagctgtctttg
aagatcaaacctcggaacattacgcggcgcaaaacagagcgcgaagaaaagacatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112248224
Entry
112248224         CDS       T05605                                 

Definition
(RefSeq) rap guanine nucleotide exchange factor 1-like isoform X1
  KO
K06277  Rap guanine nucleotide exchange factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112248224
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112248224
SSDB
Motif
Pfam: RasGEF RasGEF_N
Other DBs
NCBI-GeneID: 112248224
NCBI-ProteinID: XP_024272843
LinkDB
Position
4
AA seq 1118 aa
MSGKIESKPDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKVSKPPLEHGVKTAEKPANKSL
SRLEEQEKDVVSALRYFKTIIDKMAVDKKVLEMLPGSASKVLEAILPLVQVDARIQHSSV
VSSCLNRVYQSLGNLIRWSDQVMLEGVNLEDKETIVTVTTVIKAVLDGVKELVKLTIEKQ
EHPSPTSPVKPVPVATPPESAAEPPANEKESLDKSSATSQSMEALTEPTGEEEEEEEEVV
APPKPPLPGLKMAEHNPPALPPKKRQSAPSPTRVAVVAPMSRATSGSSLPMSIGLHKQEY
EVDALQRRFSGGSHYYGGESPRISPCNSMGKLSKSDGQLSWTMDSGQCSRNTSSEALDTT
DHYDPDYDFLHQDLSSLEQMTPVPVGACLSPLPESHSESSCPGPGPPLAQLHFSSLQGCS
VTSALPPPALPEKKRRGGACSGFSDGSYSGSSWCVSFERHPSQYDNLMEEDLPPVPPFPL
FTPDILPLCHTAGGFVSEFSGSETTDVPQSPPPLPEKKSRHILKYMQFVEDYSEPQPSVF
YQMPQSKSIYEQRNKHFQEVYGFNDSFSSSDSVHEPLPPPALPPKQRQLSMDLAAPGSGS
PDPVLVANGSLDSSLAIGLLTDSSFSDTRQTSLSESANEEGGEGEYVNLYTSSQANGDGL
SRRDSSAIDDSLEDTASENPLCNNKDMSDDRRRQKSSEDGQSSEETDELSLIDHMEIMSR
LTLKQENDDGPDVRAGSGDILLVHATETDRKDLVLYCEAFLTTYRTFITPEDLIKKLHYR
YTRFCHCPDTFKKKVSKNTFFVLVRVVDELCLVEMTEDILMQLMDLVFRLVCNGELSLAR
VLRTNILDKVEQRKLLRYTYSLKPLAARGVAARPGTLHDFRSHEIADQLTLLDAELFYKI
EIPEVLLWAKEQNEEKSANLTQFTEHFNNMSYWVRSIIILQEKAQDREKLLLKFIKIMKH
LRKLNNFNSYLAILSALDSAPIRRLEWQKTTSEGLEEYCTLIDSSSSFRVYRAALADVEP
PCIPYLGLILQDLTFVHLGNPDQINGKVNFSKRWQQFNILDSMRRFQQVHYDLKHNDDIV
SFFNDFSDHLAEEALWELSLKIKPRNITRRKTEREEKT
NT seq 3357 nt   +upstreamnt  +downstreamnt
atgtcggggaaaatagagagtaaaccagactcccaacgctcccatttgtcttccttcacc
atgaagcttatggacaagttccactctcccaaaatcaaaaggacaccctcgaagaaagtc
agtaagccgcctttagaacatggcgttaagactgcggagaaacctgctaacaagagtctg
agtcggttagaggagcaagagaaagacgtggtcagtgccttgcgttacttcaagaccatc
attgacaagatggcggtggacaagaaggtgctggagatgttaccaggctctgccagtaag
gtcctggaggccatcctgcctttagtccaagtggacgcaaggatccagcacagctcggtg
gtgtcctcctgtctgaaccgtgtgtaccagagtctgggcaatctcatccgttggtctgac
caagtcatgctggagggggtcaacctggaagataaagaaaccatcgttaccgtcaccact
gtgatcaaggcagtgcttgatggtgttaaggagctagtgaaactgaccatagagaaacag
gagcatccttcccccacgtctcctgtcaaaccagtgccagtggccaccccacccgagagt
gctgctgagccgcctgccaatgagaaggagagtctggacaagagctcagccacgtcccaa
tctatggaagccctgactgaacccactggagaggaggaggaggaggaggaggaggtggtg
gccccaccaaaaccccctctccctggcctcaagatggctgaacacaatcctcctgctctg
cctccaaagaagcgccagtctgccccctcacccacccgggtggcagtagtggcccccatg
agccgcgccaccagtggctccagtcttcccatgagcatcggcctccacaaacaggagtac
gaggtggatgccctgcagaggcgcttctctgggggcagccattactacggaggggagtcg
ccgcgcatatccccctgcaatagcatgggcaagctgagcaagtccgacgggcagctgtcc
tggacaatggacagtgggcagtgctcacgcaacaccagcagtgaggctctggacaccaca
gaccactacgacccggactacgacttcctgcaccaggacctgtccagcttggagcagatg
actcctgtgccagtgggagcgtgcctcagccccctgcctgagtcccacagcgagtcttcc
tgccctggccccggtccgccgctggcacaactccacttcagctccctccagggctgctcc
gtgacttccgccctgccgccccctgccctgccagaaaagaagcgcagaggtggcgcctgc
tcaggcttttccgacggctcctactcgggctcatcctggtgcgtttcctttgagcgccac
ccatcccagtacgacaacctcatggaggaggacctaccgcctgtgcccccctttcccctg
ttcacgcccgacatcttgcccctgtgccacaccgccggggggtttgtgtctgagttcagc
ggcagcgagacaacagatgtacctcagagtccaccgccactccctgagaagaagagccgt
cacatactgaagtacatgcagtttgtggaagactactcagagccccagccctcagttttc
taccagatgccacagagcaagagcatctatgagcaacgcaacaagcacttccaggaagtc
tacggcttcaatgactcgtttagcagcagcgactctgtccacgagcccctcccacccccg
gcactgccacccaaacagaggcagctgagcatggacctagcggccccgggcagtggcagc
cccgaccctgtgctggtggccaacggctctctggacagctctcttgctatcggtcttctc
actgactcttctttctctgacactcgtcaaacctctttgagcgaaagcgctaacgaggaa
ggcggggagggagagtacgttaatctgtacacatccagccaagccaacggagatgggctc
tcccgccgagactcgtctgccatagatgactcactggaggacactgcctcggagaaccca
ctgtgcaataacaaggacatgtccgatgaccgccgaagacaaaagtcgtctgaagatggg
cagagtagcgaggagacggatgagctttccctcatcgatcacatggagatcatgtcccgg
ttaacactaaagcaggagaacgatgacggtccagatgtccgagccggatcgggggatatt
ttattagtccacgccacagaaacggaccgcaaagatcttgtcttgtactgtgaggctttc
ctgacgacgtacagaacgttcataaccccagaggaccttatcaaaaagctgcactacaga
tacaccaggttttgtcactgcccagataccttcaagaagaaagtcagcaaaaacaccttc
tttgttcttgtccgtgtggtggacgagctgtgtctggtggagatgacggaggacatcctg
atgcagctgatggacttggtgttcaggctggtgtgtaacggtgagctgagcctggcccgc
gtcctccgcacaaacatcctggacaaggtggagcagaggaagctgctgcgctacacctac
tcgctcaaaccactggccgcaagaggtgtcgccgccagacctgggaccctgcacgacttc
cgaagtcatgagatcgccgaccagctaactctcctggatgcagagctcttctacaaaatt
gagatccctgaggtgttgctttgggctaaggagcagaacgaggagaagagtgccaacctc
acacagttcacagagcactttaacaacatgtcctactgggtacgctccataatcattctg
caagagaaagcccaggaccgagaaaagctcctcctcaaatttatcaaaataatgaagcac
ttacggaagctaaataatttcaactcatatttggcaatattatctgccttggattcagct
cccatccgaagactggagtggcagaaaacaacctcagagggcctagaggaatactgcacg
ttaatagacagctcctcgtcgttccgggtctaccgagcggcactggcagatgtggagccc
ccatgtataccatatctgggtcttatcctccaggacttgacctttgtccatctgggcaac
cctgatcaaatcaacgggaaggtcaacttctccaagcgctggcagcagttcaacatcctg
gacagcatgaggcgcttccagcaggtgcattatgatctgaaacacaacgacgatattgtc
tccttcttcaacgacttcagcgaccacctggcagaggaggctctgtgggagctgtctttg
aagatcaaacctcggaacattacgcggcgcaaaacagagcgcgaagaaaagacatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112263306
Entry
112263306         CDS       T05605                                 

Definition
(RefSeq) rap guanine nucleotide exchange factor 1-like isoform X1
  KO
K06277  Rap guanine nucleotide exchange factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112263306
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112263306
SSDB
Motif
Pfam: RasGEF RasGEF_N
Other DBs
NCBI-GeneID: 112263306
NCBI-ProteinID: XP_024295185
LinkDB
Position
12
AA seq 1189 aa
MSGKIESKQDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKVSKPPLEHSVKTAEKPANKGL
SRLEEHEKDVVSALRYFKTIIDKMAVDKKVLEMLPGSASKVLEAILPLVQVEPRIQHSSA
VSSCLNRVYQSLGNLIRWSDQVMLEGVNLEDKETIVTVTTVIKAVLDGVKELVKLTIEKQ
EHPSPTSPVKPVPPAALTESAAEPPAKEKESLDKSSATTQSTEVLTEPTEEEAEEVAPPK
PPLPGVKMAEHNPPALPPKKRQSAPSPTRVAVVAPMSHATSGSGLPMGTGLHKQEYEVDA
LQRRFSGGSHSYGGESPRLSPCNSMGKLSKSDEQLSWTVDSGQCSRNTSCETLDTTDHYD
PDYDFLHQDLSSLEQMPPLPVGGCLSPLPESHSESSSPSPCPGPGPPLAQPHFTPAYPSP
QPSLQGSSTSPLYSRMTPALPPPALPEKKRRSGASSGISDGSYSGSSWRVSFERHPSQYD
NLMEEDMPPVPPFPLFMPGVSPMTLCHSGDGFVSEFCASETADVPQSPPPLPEKKSRHIL
KYMQFVEDYSEPQPSLFYQTPQSESIYEQRNKRFQEVYSFNDSYSSDSVHEPLPPPALPP
KQRQLASHSASPSSSSSSSLSCHLQQSQAAVVEEVGSALSMSVSNSFLSRQSSLTTPMSM
DLAAPGTGGPDPVLVANGSLDSSGGSLAVCLPTDSSFSDTRQTSLSESANEEVGEGEYVN
LYSSSQAKGDGPLSRRDSSAIDDSLEDTASENPLCEDTCNDSRRQKSSEEGPSSEETDEL
SLIDHMEIMSRITLKQESDDGPDVRAGSGDILLVHATETDRKDLVLYCEAFLTTYRTFIT
PEDLIKKLHYRYTRFSHSPDTFKKRVSKNTFFVLVRVVDELCLVEMTEDILKQLMDLVFR
LVCNGELSLARVLRKNILDKVEQRKLLRYTNSLKPLAARGVAARPGTLHDFRSHEIADQL
TLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIILQEKAQDREK
LLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRLEWQKTTSEGLEEYCTLIDSSSSFR
AYRAALADVEPPCIPYLGLILQDLTFVHLGNPDLINGKVNFSKRWQQFNILDSMRRFQQV
HYDLKHNDDIVSFFNDFSDHLAEEALWELSLKIKPRNITRRKTEREEKT
NT seq 3570 nt   +upstreamnt  +downstreamnt
atgtcggggaaaatagagagtaagcaagactcccaacgctcccatttgtcttccttcacc
atgaagcttatggacaagttccattctcccaaaatcaaaaggacaccctcgaagaaagtc
agtaagccacctttagaacatagcgtcaagactgcggagaaacctgctaacaagggtttg
agtcggttagaggagcatgagaaagacgtggtcagtgccttgcgttacttcaagaccatc
attgacaagatggcggtggacaagaaggtgctggagatgttaccaggctctgccagtaag
gtcctggaggccatcctgcctttagtccaagtggaaccaaggatccagcacagttcagcg
gtgtcatcttgtcttaaccgtgtgtaccagagtctgggcaatctcattcgctggtctgac
caagttatgctggagggggtcaacctggaagataaagaaaccattgttaccgtcaccact
gtgatcaaggcagtgctcgacggtgttaaggagctggtgaaactgaccatcgagaaacag
gagcatccctcccctacgtctcctgtcaaaccagtgccaccggccgccctgactgagagc
gctgcagagccacctgccaaagagaaggagagtctggacaagagttcagccacaacccaa
tctacggaagtcttgactgaacccaccgaggaggaagcagaggaggtggcccctccgaaa
ccccctctccctggcgtaaagatggctgaacacaatcctccagctctccctccaaagaag
cgccagtcggcgccctcccccactcgggtggcagtggtggcccccatgagccacgccacc
agtggctccggtcttcccatgggcactggcctccacaagcaggagtacgaggtggacgcg
ttgcagcggcgcttctcagggggcagccattcgtacggaggggagtcgccgcgcctgtcg
ccctgcaacagcatgggcaagctgagcaagtcggacgagcagctatcctggacagtggac
agtggacagtgctcacgcaacaccagctgtgagactctggacaccacagaccactacgac
ccggactacgacttcctgcaccaggacctgtccagcctggaacagatgcctcccctgccg
gtgggggggtgcctcagccccctgcccgaatcccacagcgagtcctcctccccttccccg
tgccctggccccggcccaccactggcccaaccccacttcacccctgcctacccctccccc
cagccgtccctccagggctcctccacgtcccctctctactcccgcatgactccggcattg
ccgccccccgccctgccagaaaagaagcgccgcagcggggccagctcgggcatctctgac
ggctcctactcgggctcctcctggcgtgtctccttcgagcgtcacccgtcccagtatgac
aacctcatggaggaggacatgccgcctgtgccccccttccccctgttcatgcctggcgtc
tcgcccatgaccctgtgccactccggtgatgggtttgtgtctgagttctgtgccagcgag
acggcagacgtcccccagagtccacccccactccccgagaagaagagccgccacatactg
aagtacatgcagtttgtggaggactactcggagccccagccctcacttttctaccagaca
ccgcagagcgagagcatctacgagcaacgcaacaaacgcttccaggaagtctacagcttc
aacgactcgtatagcagtgactctgttcacgagcctctcccacccccggcactgccaccc
aaacagaggcagctggcctcccactctgcgtctccctcttcctcgtcctcatcctctctc
tcctgccacctccagcagtcgcaggctgcggtggtggaggaggtggggtctgcgctcagc
atgtccgtctctaactccttcctgagccgccagtcctccctgaccacccccatgagcatg
gacctagctgccccgggcactggcggccctgaccctgtgctggtggccaacggctcactg
gacagctctggtggctctcttgcagtctgccttcccactgactcttctttctctgacact
cgtcaaacctctttgagtgaaagcgctaatgaggaagtcggggagggagagtacgtcaat
ctgtactcatccagccaagccaaaggagacgggccgctctcccgccgagactcatccgcc
atagatgactcactggaggacactgcctcagagaacccactgtgcgaggacacgtgcaat
gacagccgaaggcaaaagtcctcagaagaagggccgagtagcgaagagacggatgaactt
tccctcatcgatcacatggagatcatgtcccggataacactaaagcaggagagcgacgac
ggtccagatgtccgagccggatcgggggatattttattagtccacgccacagaaacagac
cgcaaagatcttgtcttgtactgtgaggctttcctgacgacgtacagaacatttataacc
cccgaggacctcatcaaaaagctgcactacagatacaccagatttagtcacagcccagac
accttcaagaagagagtcagcaaaaacaccttcttcgttctggtccgtgtggtggacgag
ctgtgtttggtggagatgacggaggacatcctgaagcagctgatggacctggtgttcagg
ctggtgtgtaacggtgagctgagcctggcccgcgtgctccgcaagaacatcctggacaag
gtggagcagaggaagctgctgcgctacaccaactcccttaaaccactggccgcgcgaggt
gtcgctgccagaccggggaccctgcatgatttccgcagtcacgaaattgctgaccagcta
actctcctggacgcggagctcttctacaaaattgagatccctgaggtgttgctttgggct
aaggagcagaacgaggaaaagagtcctaacctcacacaattcacagagcactttaacaac
atgtcctactgggtacgctccataatcattctgcaggagaaagcccaggaccgagaaaag
ctcctccttaaattcatcaaaataatgaagcacttacggaagctaaataatttcaactcg
tatttggcaatattatctgccttggattcggctcccatccgaagactggaatggcagaaa
acaacctccgagggcctagaggaatactgcacgttgatagatagctcctcgtcgttccgg
gcctaccgagcggcactggctgacgtggagcccccatgtataccatatctgggacttatc
ctccaggacttaacctttgtccatctgggcaaccctgacctcatcaacgggaaggtcaac
ttctcaaaacgctggcagcagttcaatatcctggacagcatgaggcgcttccagcaagtg
cattatgatctgaaacacaacgacgacatcgtctcctttttcaatgacttcagcgaccac
ctggcagaggaggctctgtgggagctgtctctaaagatcaaacctcggaacattacgcgg
cgcaaaacagagcgcgaagagaagacatag

DBGET integrated database retrieval system