KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112231367
Entry
112231367         CDS       T05605                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2-like
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04270  Vascular smooth muscle contraction
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04540  Gap junction
otw04620  Toll-like receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112231367
   04012 ErbB signaling pathway
    112231367
   04370 VEGF signaling pathway
    112231367
   04371 Apelin signaling pathway
    112231367
   04068 FoxO signaling pathway
    112231367
   04150 mTOR signaling pathway
    112231367
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112231367
  09143 Cell growth and death
   04210 Apoptosis
    112231367
   04218 Cellular senescence
    112231367
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112231367
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112231367
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112231367
  09152 Endocrine system
   04910 Insulin signaling pathway
    112231367
   04912 GnRH signaling pathway
    112231367
   04916 Melanogenesis
    112231367
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112231367
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112231367
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112231367
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     112231367
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE7 family
   112231367
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 112231367
NCBI-ProteinID: XP_024253902
LinkDB
Position
1
AA seq 401 aa
MAPKRRPVPLNITPIGEGQSISTTIDAASEANLEALQKKLGELDLDEQQRKRLEAFLTQK
AQVGELKDDDFHPICELGAGNGGVVNKVRHKPSRLVMARKLIHLEIKPAIRNQIIRELQV
LHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIPEEILGKVSIAVLRGL
AYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQG
THYSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEAIFGRPVQDGAEGEPQAPSNRLPRP
PGGRPVSGHGMDSRPAMAIFELLDYIVNEPPPRLPLGVFTNDFQEFVTKCLIKNPAERAD
LKMLMNHTFIKRAEVEEVDFAGWMCKTMGLNQPSTPTRITE
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggctccgaagagaagacccgttcccctaaatatcacgcccattggagaggggcagtcc
atctccacgaccatcgatgctgcgtccgaagccaatctggaggccttacagaagaagcta
ggagagctagatttggacgaacagcagaggaaacgtctggaggctttcctcacccagaaa
gcccaagtgggcgagctgaaagatgacgatttccaccccatatgtgagctgggcgctggc
aacggtggagtggtcaacaaggtccgccacaaaccctccagactggtcatggcccggaag
ctcatccacctggagattaagcctgccatcaggaaccagataatcagagagctgcaggtg
ctccatgagtgtaactctccctacatcgtgggcttctacggggccttctacagtgatggc
gagatcagtatctgtatggagcacatggatggaggctctctggatcaggttctgaaggaa
gccaggagaatccctgaggaaatcctgggcaaagtcagcatagcagtactcagaggactt
gcctatctgcgggaaaaacaccagatcatgcacagagacgtcaagccctccaacatcctg
gtgaactcgcgcggggagatcaagctgtgtgactttggcgtgagtggccagctcatcgac
tccatggccaactccttcgtgggaacgcgctcctacatgtcgccggagagactgcagggc
acacactactctgtgcagtcagacgtgtggagcatgggcctgtccctggtggagctggcc
atcggccgctaccccatccccccgcctgacgccaaggagctggaagccatctttggccgg
ccagtacaggatggagctgagggggaaccacaggccccctccaaccgcctccccagacca
ccaggaggacgaccagtcagcggacatgggatggacagtcgacctgccatggctatattt
gagctactggactacattgtcaatgagcctcctcccaggcttccactcggtgtcttcacc
aacgatttccaggagtttgtgacaaaatgtctgatcaagaatccagcggagagagctgac
ctgaagatgctgatgaaccacacgtttatcaagcgtgctgaggtggaggaggtggacttt
gctggctggatgtgtaaaaccatgggcctcaaccaacccagcaccccaacccgcatcaca
gaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112237794
Entry
112237794         CDS       T05605                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2-like
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04270  Vascular smooth muscle contraction
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04540  Gap junction
otw04620  Toll-like receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112237794
   04012 ErbB signaling pathway
    112237794
   04370 VEGF signaling pathway
    112237794
   04371 Apelin signaling pathway
    112237794
   04068 FoxO signaling pathway
    112237794
   04150 mTOR signaling pathway
    112237794
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112237794
  09143 Cell growth and death
   04210 Apoptosis
    112237794
   04218 Cellular senescence
    112237794
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112237794
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112237794
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112237794
  09152 Endocrine system
   04910 Insulin signaling pathway
    112237794
   04912 GnRH signaling pathway
    112237794
   04916 Melanogenesis
    112237794
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112237794
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112237794
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112237794
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     112237794
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE7 family
   112237794
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 112237794
NCBI-ProteinID: XP_024262170
LinkDB
Position
Unknown
AA seq 401 aa
MAPKKRPVRLNITPTAGEGGLSTSTTIAAASDANLEALQKKLEELDLDEQQKKRLENFLT
QKAKVGELKDDDFHRICELGVGNGGVVNKVCHKPSGLVMARKLIHLEIKPAIRNQIIREL
QLLHECNSPYIVSFYGSFYSDGEISICMEHMDGGSLDQVLKEARRIPEEILGKVSIAVLR
GLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERL
QGTHYSVQSDVWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPIMDGTEGEMHSSTSPRP
RPPGGRPASGHGPAMAIFELLDYIIVLLQPPPKLPHGVFTSDFQDFVTRCLIKNPADRAD
LKMLMNHTFIKRSEVEEMDFAGWLCKTMGLNQPSTPTRTAD
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggcccccaaaaaaagaccagtgcgccttaacatcactcccactgctggtgagggagga
ttgtccacctccacaaccatcgcagctgcctctgatgctaacttggaagccctacagaag
aagttggaggagttggatctggacgagcagcagaagaagcgcctggagaatttccttacc
cagaaggccaaggtgggcgaactgaaagacgatgacttccaccgcatttgtgagttgggt
gtcggcaacggaggcgtggtcaacaaggtgtgccacaaaccctcaggcctcgtcatggcc
agaaagctgatccatctggagatcaagccagccatcaggaaccagatcatcagagagcta
cagttgctacatgagtgtaattctccctacatcgttagtttctacgggtccttctacagc
gatggagagatcagcatctgcatggaacacatggatgggggctctctggaccaggtgctg
aaagaggccaggaggatccctgaggagatcctggggaaagtcagcatcgctgttctaaga
gggttagcgtatctacgagagaaacaccagatcatgcacagagacgtaaagccctctaat
atcctggtcaactctcgtggggagatcaagctctgtgacttcggggtgagcggccagctg
atagactccatggccaactccttcgtgggaacacgttcctacatgtcgccggagagattg
cagggcactcactactctgtccagtctgatgtgtggagcatgggactgtctctggtggag
ctgtctatcggccggtatcccatccccccgcctgacgccaaggagctggaggccatcttt
ggccgacccatcatggacgggaccgagggagaaatgcacagcagcacctctccccgaccc
agaccccccgggggcagacctgccagcggccacggtcctgcaatggccatctttgagctg
ctggactacatcattgttttgttacagcctccccccaagctgcctcatggagtattcaca
tctgatttccaggactttgtgaccagatgtctcatcaagaacccagcagaccgggcggac
ttgaagatgctgatgaaccacacttttatcaagcgatctgaggtagaggagatggacttc
gctggctggctctgtaaaaccatggggctgaaccaacccagcactcccacacgcactgca
gactaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250875
Entry
112250875         CDS       T05605                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04270  Vascular smooth muscle contraction
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04540  Gap junction
otw04620  Toll-like receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112250875
   04012 ErbB signaling pathway
    112250875
   04370 VEGF signaling pathway
    112250875
   04371 Apelin signaling pathway
    112250875
   04068 FoxO signaling pathway
    112250875
   04150 mTOR signaling pathway
    112250875
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112250875
  09143 Cell growth and death
   04210 Apoptosis
    112250875
   04218 Cellular senescence
    112250875
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112250875
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112250875
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112250875
  09152 Endocrine system
   04910 Insulin signaling pathway
    112250875
   04912 GnRH signaling pathway
    112250875
   04916 Melanogenesis
    112250875
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112250875
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112250875
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112250875
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     112250875
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE7 family
   112250875
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 112250875
NCBI-ProteinID: XP_024277152
LinkDB
Position
5
AA seq 401 aa
MAPKRRPVPLNITPIGEGQSISTTIDAASEANLEALQKKLGELDLDEQQRKRLEAFLTQK
AQVGELKDDDFHPICELGAGNGGVVNKVRHKPSRLVMARKLIHLEIKPAIRNQIIRELQV
LHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIPEEILGKVSIAVLRGL
AYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQG
THYSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEAIFGRPVQDGAEGEPHTISNRLPRP
PGGRPVSGHGMDSRPAMAIFELLDYIVNEPPPRLPLGVFTNDFNEFVTKCLIKNPAERAD
LKMLMNHTFIKRAEVEEVDFAGWMCKTMGLNQPSTPTRGTE
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggctccgaagagaagacccgttcccctaaatatcacgcccattggagaggggcagtcc
atctccacaaccatcgatgctgcgtctgaagccaatctggaggccttacaaaagaagcta
ggagagctagatttggacgaacagcagaggaaacgtctggaggctttcctcacccagaaa
gcccaagtgggcgagctgaaagatgatgatttccaccccatatgtgagctgggcgctggc
aacggtggagtggtcaacaaggtccgccacaaaccctccagactggtcatggcccgaaag
ctcatccacctggagattaagcctgccatcaggaaccagatcatcagagagctgcaggtg
ctgcatgagtgcaactctccctacatcgtgggcttctacggggccttctacagcgacgga
gagatcagtatctgcatggagcacatggatggaggctctctggatcaggtgctgaaggaa
gccaggagaatccctgaggagatcttgggcaaagtcagcatagcagtactcagaggactt
gcctatctgcgggagaagcaccagatcatgcacagagacgtcaagccctccaacatcctg
gtgaactcgcgcggggagatcaagctgtgtgacttcggcgtgagtggccaactcatcgac
tccatggccaactccttcgtgggaacgcgctcctacatgtcgccggagagactgcagggc
acacactactctgtgcagtcggacgtgtggagcatgggcctgtccctggtggagctggcc
atcggccgctaccccatccccccgcctgatgccaaggagctggaggccatctttggccgg
cccgtacaggacggagccgagggggaaccacacaccatctccaaccgcctccccagacca
ccaggagggcgaccagtcagcggacatgggatggacagtcgaccagccatggcgatattt
gagctgctggactacattgtcaatgagcctcctcccaggctgccacttggtgtcttcacc
aacgatttcaacgagtttgtgacaaaatgtctgatcaagaatccagcagagcgagctgac
ctgaagatgctgatgaaccacacgtttatcaagcgtgctgaggtggaggaggtggacttt
gctggctggatgtgtaaaaccatgggcctcaaccaacccagcacccctacccgtggcact
gaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112262497
Entry
112262497         CDS       T05605                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1-like
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04270  Vascular smooth muscle contraction
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04620  Toll-like receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112262497
   04012 ErbB signaling pathway
    112262497
   04370 VEGF signaling pathway
    112262497
   04371 Apelin signaling pathway
    112262497
   04068 FoxO signaling pathway
    112262497
   04150 mTOR signaling pathway
    112262497
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112262497
  09143 Cell growth and death
   04114 Oocyte meiosis
    112262497
   04210 Apoptosis
    112262497
   04218 Cellular senescence
    112262497
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112262497
   04540 Gap junction
    112262497
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112262497
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112262497
  09152 Endocrine system
   04910 Insulin signaling pathway
    112262497
   04912 GnRH signaling pathway
    112262497
   04914 Progesterone-mediated oocyte maturation
    112262497
   04916 Melanogenesis
    112262497
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112262497
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112262497
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112262497
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     112262497
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE7 family
   112262497
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 112262497
NCBI-ProteinID: XP_024293910
LinkDB
Position
1
AA seq 320 aa
MQKRRKPEPIQLNPIPDGNTVNGTGATETNLEALQKKLEELELDEQQRKRLEAFLTQKQK
VGELKDHDMEKICELGAGNGGVVFKVSHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLH
ECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQSLKKAGKIPEQIRGKVSIAVIKGLSY
LREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTH
YSVQSDIWSMGLSLVEMAVGRFPIPPPDTRELEIIFGFPVEGDACSSDTTSPKPIPPGQP
GSSCGQTADLLWLSLNCWTT
NT seq 963 nt   +upstreamnt  +downstreamnt
atgcagaagagaagaaagcctgaaccgatccaactcaaccctattcccgatggaaacact
gtcaacggcactggtgccacggagactaacctagaggcccttcagaagaagctagaggag
ttggaacttgatgaacagcagcgtaaacgcctggaggcctttctcacccagaaacagaag
gttggagagctgaaggatcatgatatggaaaagatctgtgagctgggagccgggaacgga
ggggttgtcttcaaagtttcacacagaccctcagggctcatcatggccaggaagttgatc
cacctggagatcaagccggccatcaggaaccagatcatcagagagctgcaggttctgcat
gagtgtaactccccctacattgtgggcttctacggggccttctacagcgatggagagatc
agcatctgtatggaacacatggacggtggttctctggatcagtctctgaagaaagcagga
aagataccagaacagatccgggggaaagtcagcatcgctgtgattaaaggcctgtcctac
ctgagagagaaacacaagatcatgcatagagatgtgaagccatctaacatcctggttaac
tcccgtggtgagatcaagctgtgtgactttggagtgagcggtcagctcatcgactccatg
gccaactcctttgtgggaacccgctcctacatgtctccggagcgtctccagggaactcac
tactctgtccagtctgatatctggagtatgggtctctctctggttgagatggctgtcgga
cgcttccccatccctccccccgacacccgcgaactggaaattatctttgggttcccggtg
gaaggggacgcctgttctagtgacaccacctctcccaagcccataccccccggacagcca
ggcagctcctgtgggcagacagcagacctcctatggctatctttgaactgctggactaca
tag

DBGET integrated database retrieval system