KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112231377
Entry
112231377         CDS       T05605                                 

Definition
(RefSeq) erythropoietin-like
  KO
K05437  erythropoietin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112231377
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112231377
Cytokines and growth factors [BR:otw04052]
 Cytokines
  CSF and other factors
   112231377
SSDB
Motif
Pfam: EPO_TPO Y_phosphatase
Other DBs
NCBI-GeneID: 112231377
NCBI-ProteinID: XP_024253880
LinkDB
Position
33
AA seq 184 aa
MSSISGLVAVLLTVLQWAGRGLPSPVRPICDPRVLDRFIMEARDTETALRGCKAGCGVTG
TFVVPLTNVDFVVLETKDTEEQALEVQSGLFLFGQALGAVRESVSRAAVKSLIDNNKSNI
HSLGQVLRSLHIKDLSLSPAPAVGDSATRKVSSLSELLRVHTNFLRGKVRLLLTNAPACQ
QNST
NT seq 555 nt   +upstreamnt  +downstreamnt
atgtcttccatttcagggctggtggcggtactgctgacggtactccagtgggcagggcga
ggcctcccttctcctgtcaggcccatctgtgacccccgcgttctggaccgtttcatcatg
gaggcccgcgacacagagaccgctctgcgaggttgcaaggcaggatgtggcgtgacaggc
accttcgtggttccactgaccaacgttgactttgtggtattggagacaaaggatactgag
gagcaggctctggaggtccagtcgggactgtttctgttcggccaggccctgggtgctgtg
agggagtcagtgagccgtgctgccgtaaagagcctcatcgacaacaacaagagcaacatc
cacagcctgggccaggtgctgcgcagcctccacatcaaggacctgtccctctctccagcg
ccagcagtaggtgactcagcgaccaggaaggtgtcgtccctatccgagctgctccgtgtc
cacaccaacttcctacgagggaaggttcgcctgctgctcaccaacgcacctgcctgtcaa
cagaacagcacgtga

DBGET integrated database retrieval system