KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112231466Help
Entry
112231466         CDS       T05605                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112231466
Enzymes [BR:otw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     112231466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu DUF296
Motif
Other DBs
NCBI-GeneID: 112231466
NCBI-ProteinID: XP_024253988
LinkDB All DBs
Position
33
AA seq 154 aa AA seqDB search
MAMKAVCVLKGTGEVTGTVFFEQEGVDGPVKLIGVISGLAPGKHGFHVHAFGDNTNGCMS
AGPHFNPHNKTHGGPTDAVRHVGDLGNVTAGADNVAKINIQDEMLTLTGPNSIIGRTMVI
HEKADDLGKGGNEESLKTGNAGSRQACGVIGIAQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgaaggctgtttgcgtgctcaaaggcaccggtgaagttaccgggaccgtattc
tttgagcaggagggtgtcgatggtccagtgaagctgattggggtgatctctggtctggcc
ccggggaaacatggcttccacgtccatgcttttggagacaacaccaacggctgtatgagt
gccggaccccactttaacccccacaacaagacccacggaggacccactgatgctgttcgg
cacgtaggggaccttggcaacgtgactgcaggagctgacaatgtggctaagatcaacatc
caggatgagatgttgactctcactggacccaactctatcatcggcaggaccatggtgatc
catgagaaggctgatgatctgggaaaaggaggcaacgaggagagtctgaagactggcaac
gctggcagtcggcaggcctgtggcgttattggcattgcccagtaa

DBGET integrated database retrieval system