KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232653Help
Entry
112232653         CDS       T05605                                 

Definition
(RefSeq) peptidase inhibitor 15-like
  KO
K20412  peptidase inhibitor 16
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:otw04090]
    112232653
CD molecules [BR:otw04090]
 Proteins
  112232653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAP
Motif
Other DBs
NCBI-GeneID: 112232653
NCBI-ProteinID: XP_024255611
LinkDB All DBs
Position
Unknown
AA seq 337 aa AA seqDB search
MLRGTLLWAGLMGFYVIITQCPASCQLSEDDAETLVELHNSYRGQVVPNSTYMHKVKWDE
NLKIIAEGYAVKCIWEHNPDLEELNMGENLFVSNGLFDPNIAMEKWFLEHLDYDYNNNSC
QDNKMCGHYTQMVWADSHSVGCAVHRCDTMEGLSFEKATFLVCNYYPAGNFNDEKPYEEG
EWCSKCPDNLPRCDQNLCVPDAPELTEEPDVEKETMDSSPPGTDEPSTHTATATTTATAT
EDTPPSPPRTQPDYSSAPEPTMAGREETGTEPGDEEEEEEEEEEEQEEEEEEKWEGEERA
TEREKDSTREQPPSNAGSVSTSLLLVTSLMPLLSLGL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgctgagggggacacttctctgggctggcctgatgggattctatgtcatcatcacccag
tgtccagcctcttgccagctgagcgaggacgacgcagagaccctcgtggagctgcacaac
agctaccgtggccaggtggtgcccaattccacctacatgcataaagtgaaatgggatgag
aatctgaagatcatagctgagggctatgctgtgaagtgtatatgggagcacaacccggat
ctagaggagctgaacatgggagagaacctgtttgtgtccaacggactctttgaccccaac
attgccatggagaagtggttcctggagcacctagactacgactacaacaacaacagctgc
caggataataagatgtgtggacactacactcagatggtgtgggcggactctcactcagtg
ggctgtgctgttcatcgctgtgacaccatggaggggctgtcctttgagaaagccaccttc
ctagtctgcaattattacccagcaggtaactttaatgatgagaaaccctatgaggaaggt
gaatggtgctccaagtgtccagacaacctgccgcgatgtgaccagaacctctgtgtgcct
gatgcccctgagcttacagaggagcctgatgtagagaaggagacaatggacagctctccc
ccaggcactgatgagccctccacacacacagccacagccaccaccacagccacagccaca
gaggacacaccgccatcaccaccgaggacacaaccagactactcttcagcccctgagcca
accatggctggcagagaggagacaggcacagagcctggggatgaggaggaggaggaggag
gaggaggaggaggagcaggaggaggaggaggaggagaagtgggagggggaggaaagagct
acagagagggagaaggacagtactagggaacaacctccgtccaacgcaggaagtgtttct
acttccctacttctggttactagcttgatgcctttactgtcactgggattgtga

DBGET integrated database retrieval system