KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232965
Entry
112232965         CDS       T05605                                 

Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112232965
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112232965
Enzymes [BR:otw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     112232965
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-GeneID: 112232965
NCBI-ProteinID: XP_024256073
LinkDB
Position
Unknown
AA seq 226 aa
MSMLSRVGQVRRCAATVTPVLGTVAARWKHSLPDLTYDYGALEPHVNAEIMQLHHSKHHA
TYVNNLNVTEEKYQEALAKGDVTAQVSLQPALRFNGGGHINHTIFWTNLSPNGGGEPQGE
LAAAINRDFGSFQALKDKMSASTVAVQGSGWGWLGFDKESGKLRITACPNQDPLQGTTGL
VPLLGIDVWEHAYYLQYKNVRPDYVKAIWNVINWENVSERLQAAKK
NT seq 681 nt   +upstreamnt  +downstreamnt
atgagcatgctaagcagagtgggtcaagtccgcaggtgtgctgccactgtgaccccagtc
ctgggcacggtggcagccagatggaagcactcactccctgacctgacctacgactatgga
gccctggagccccacgtcaatgcagagatcatgcagctccaccacagtaagcaccatgcc
acctatgttaacaacctcaacgtcacagaggagaagtaccaggaggcactggccaaaggt
gatgtgacagcacaggtttctctccagcctgctctgaggtttaatggaggaggccacatc
aaccacaccatcttctggacaaacctctctccaaatggcggtggagaaccacagggtgag
ctggcagcggccatcaaccgtgactttggctccttccaggcattgaaggacaagatgtct
gcctccactgtggcggtccagggctcgggctggggctggctgggcttcgacaaggagagc
gggaagctccgtatcacagcctgccctaatcaagacccactgcagggaaccacaggtctg
gtccccctgcttggtattgatgtgtgggagcatgcctactatctacagtacaagaatgtc
cgacccgactatgtcaaagccatctggaatgtcatcaactgggagaacgtgagcgagcgc
ctccaggccgccaaaaagtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250306
Entry
112250306         CDS       T05605                                 

Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112250306
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112250306
Enzymes [BR:otw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     112250306
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-GeneID: 112250306
NCBI-ProteinID: XP_024276126
LinkDB
Position
5
AA seq 226 aa
MSMLSRVGQVRRCAATVTPVLGTVAARWKHSLPDLTYDYGALEPHVNAEIMQLHHSKHHA
TYVNNLNVTEEKYQEALAKGDVTAQVSLQPALRFNGGGHINHTIFWTNLSPNGGGEPQGE
LAAAINRDFGSFQALKDKMSASTVAVQGSGWGWLGFDKESGKLRITACPNQDPLQGTTGL
VPLLGIDVWEHAYYLQYKNVRPDYVKAIWNVINWENVSERLQAAKK
NT seq 681 nt   +upstreamnt  +downstreamnt
atgagcatgctaagcagagtgggtcaagtccgcaggtgtgctgccactgtgaccccagtc
ctgggcacggtggcagccagatggaagcactcactccctgacctgacctacgactatgga
gccctggagccccacgtcaatgcagagatcatgcagctccaccacagtaagcaccatgcc
acctatgttaacaacctcaacgtcacagaggagaagtaccaggaggcactggccaaaggt
gatgtgacagcacaggtttctctccagcctgctctgaggtttaatggaggaggccacatc
aaccacaccatcttctggacaaacctctctccaaatggcggtggagaaccacagggtgag
ctggcagcggccatcaaccgtgactttggctccttccaggcattgaaggacaagatgtct
gcctccactgtggcggtccagggctcgggctggggctggctgggcttcgacaaggagagc
gggaagctccgtatcacagcctgccctaatcaagacccactgcagggaaccacaggtctg
gtccccctgcttggtattgatgtgtgggagcatgcctactatctacagtacaagaatgtc
cgacccgactatgtcaaagccatctggaatgtcatcaactgggagaacgtgagcgagcgc
ctccaggccgccaaaaagtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250590
Entry
112250590         CDS       T05605                                 

Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112250590
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112250590
Enzymes [BR:otw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     112250590
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-GeneID: 112250590
NCBI-ProteinID: XP_024276636
LinkDB
Position
5
AA seq 226 aa
MSMLSRVGQVRRCAATVTPVLGTVAARWKHSLPDLTYDYGALEPHVNAEIMQLHHSKHHA
TYVNNLNVTEEKYQEALAKGDVTAQVSLQPALRFNGGGHINHTIFWTNLSPNGGGEPQGE
LAAAINRDFGSFQALKDKMSASTVAVQGSGWGWLGFDKESGKLRITACPNQDPLQGTTGL
VPLLGIDVWEHAYYLQYKNVRPDYVKAIWNVINWENVSERLQAAKK
NT seq 681 nt   +upstreamnt  +downstreamnt
atgagcatgctaagcagagtgggtcaagtccgcaggtgtgctgccactgtgaccccagtc
ctgggcacggtggcagccagatggaagcactcactccctgacctgacctacgactatgga
gccctggagccccacgtcaatgcagagatcatgcagctccaccacagtaagcaccatgcc
acctatgttaacaacctcaacgtcacagaggagaagtaccaggaggcactggccaaaggt
gatgtgacagcacaggtttctctccagcctgctctgaggtttaatggaggaggccacatc
aaccacaccatcttctggacaaacctctctccaaatggcggtggagaaccacagggtgag
ctggcagcggccatcaaccgtgactttggctccttccaggcattgaaggacaagatgtct
gcctccactgtggcggtccagggctcgggctggggctggctgggcttcgacaaggagagc
gggaagctccgtatcacagcctgccctaatcaagacccactgcagggaaccacaggtctg
gtccccctgcttggtattgatgtgtgggagcatgcctactatctacagtacaagaatgtc
cgacccgactatgtcaaagccatctggaatgtcatcaactgggagaacgtgagcgagcgc
ctccaggccgccaaaaagtag

DBGET integrated database retrieval system