KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233440Help
Entry
112233440         CDS       T05605                                 

Definition
(RefSeq) lysophosphatidic acid receptor 3-like
  KO
K04294  lysophosphatidic acid receptor 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112233440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:otw04030]
    112233440
G protein-coupled receptors [BR:otw04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    112233440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 Dopey_N BBL5
Motif
Other DBs
NCBI-GeneID: 112233440
NCBI-ProteinID: XP_024256854
LinkDB All DBs
Position
Unknown
AA seq 360 aa AA seqDB search
MASQNKCYHDEPMSFFYNNSNQTKDDWNSTQLILVQVVGSLFCCFILVSNAMVIAAIITN
KRFHYPFYYLLANLAASDFLAGIAYVYLMFNTGTVSRKLTVRGYFIRQGLLDTSLSASLA
NLLVIALERYISVMNWKVHSNLTKRRVTMLIVLVWAISIFMGTVPSLGWNCICNLQDCSQ
LAPIFSRSYLIFWSVSNLVLFLVMVSIYLRIYTYVKRKTAVLSPHTSGSINRKRTPIKLI
KTVMTVLGAFVICWTPGLVVLLLDGLHCQQCEVMLFKRWLLLLAVLNSVMNPVIYSYKDD
EMWTTFKNLLRCVGNGTRRQRSSRANARPLSSAQETGTTPQTSEEKETTKDSDAQEMLKA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggccagccagaacaaatgctaccatgatgagccaatgagcttcttctacaacaacagc
aaccagaccaaagacgactggaactccacacagctcattctggtacaagttgtaggctcc
ctcttctgctgctttatcctggtgtccaacgccatggtcattgccgccatcatcaccaac
aagaggttccactacccgttctactatctccttgccaacctggccgcttcagacttcctc
gctggaatagcctacgtatacctcatgttcaacaccgggacggtgtccaggaaactaacc
gtgaggggctatttcattcgtcaagggcttctggacaccagtctctcagcctctctggcg
aacttgctagtgatcgccttggagcgctacatctctgtgatgaactggaaggtccacagt
aacttgaccaagcggcgggtgaccatgctcattgtgctggtgtgggccatctctatcttc
atgggcaccgtgcccagcctggggtggaactgcatctgcaaccttcaggactgctcccag
ctggcgcccatcttcagccggagctacctgattttctggtccgtgtccaacctggttttg
ttcctggtcatggtgtccatctacctgcggatttacacctacgtcaagaggaaaacggcg
gtgctcagcccgcacaccagcggctccatcaaccgcaagaggacacccatcaagctcatc
aagacagtcatgactgtgttaggggcgtttgtgatctgctggacgccgggcctggtggtg
ctgctgctagacggcctccattgccagcagtgcgaggtgatgctctttaagcgctggctc
ctcctgctggcagtactcaactcggtcatgaaccctgtcatctactcttacaaggatgac
gagatgtggaccaccttcaagaacctgcttcgctgcgtgggcaatggcacccggcgccag
cgctcgtccagggccaacgcccggcccctcagctcagcccaggagacgggcaccacgccg
cagacctctgaggagaaggagaccaccaaggactcggacgcccaggagatgctcaaggcc
tga

DBGET integrated database retrieval system