KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233788
Entry
112233788         CDS       T05605                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1
Other DBs
NCBI-GeneID: 112233788
NCBI-ProteinID: XP_024257414
LinkDB
Position
Unknown
AA seq 388 aa
MLTMGSEPPQAVARLFAWVNGMSKCELIELKDLSLNDRIELAPDPPASLPPAAPLTPRQM
RAPERPSHVVRLVGDSVSVEGPSWFTGQVGKGHDFQPCSYTQISWCDLCGEFIWGLYKQS
LSCANCSYTCHFQCRPFIQLDCSTESRLLTTDQTDVSEDTVETDTNVDVIEPIDWGKQVL
SVGDIQQKVKEYNAQINSNLYMVLNRDGSYTGFIRVLFKLTRPVSLPPPRKASSPQEEGQ
QEGGLKHRTSFYLPKDTAKHLHISSQTRVREVIEALLNKFTVVDNPAKFALFERSERENQ
IYLRKLSDDERPLHLRLCAGPNEKVLSLVLKENETGEVNWDAFSFPELRNFLRILQREEE
EHVRQIVKRYALARDRMKEAMASITTPG
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgctaaccatgggaagtgagccgccacaagccgtcgcccggctgtttgcctgggtaaat
ggcatgtccaagtgtgagctgattgagctgaaagacctcagcctgaatgatcgcatagag
ctggcaccagacccaccagcctctctgcccccagcagcgcccctgacccccaggcagatg
agggctccggagaggcccagccacgtggtccggctggtgggggacagtgtgagtgttgag
gggccctcgtggttcacaggtcaggttggaaagggacatgacttccagccctgcagttac
acccagatcagctggtgcgatttgtgtggtgaattcatctggggcctttacaaacagagc
ctgagctgtgctaactgcagttacacctgtcacttccagtgtcgaccgtttatccagttg
gattgcagcaccgagagtagactcctcactaccgaccaaacagatgtttctgaagacacc
gtagagacagacactaacgtggatgtgattgaacctattgactgggggaaacaagtgctg
tctgtcggtgacatccagcagaaggtgaaggaatataatgctcagatcaacagcaatctc
tacatggtgctgaacagagatggatcctacactggcttcatcagggtcctttttaagctg
actcggcccgtgtcactcccaccccctcggaaggcgtcttcaccacaggaagagggacaa
caggagggggggcttaagcaccggacatctttctacctccccaaagacacggccaaacac
ctgcatataagctcccagacgcgggtacgtgaggtcatagaggccctgctcaacaagttc
accgtggtggacaaccctgccaagtttgctctgtttgagcgcagcgaacgtgaaaaccag
atataccttcgtaagctgtctgatgacgagagaccgctccacctgcgtctgtgtgccgga
cccaatgagaaagtcctcagtctggtgttgaaagagaatgagacgggggaggtcaattgg
gatgcattcagctttcctgagctgcgtaatttcctgaggatccttcagcgtgaggaagag
gagcacgtccggcagatagtcaagcgctacgctctggccagggataggatgaaggaggcc
atggccagcatcaccacccctggctga

DBGET integrated database retrieval system