KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234013
Entry
112234013         CDS       T05605                                 

Definition
(RefSeq) adenylate cyclase type 3-like isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00230  Purine metabolism
otw01100  Metabolic pathways
otw04020  Calcium signaling pathway
otw04114  Oocyte meiosis
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04540  Gap junction
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112234013
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112234013
   04020 Calcium signaling pathway
    112234013
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112234013
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112234013
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112234013
   04914 Progesterone-mediated oocyte maturation
    112234013
   04916 Melanogenesis
    112234013
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112234013
   04270 Vascular smooth muscle contraction
    112234013
Enzymes [BR:otw01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     112234013
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053 OPA3
Other DBs
NCBI-GeneID: 112234013
NCBI-ProteinID: XP_024257756
LinkDB
Position
3
AA seq 1122 aa
MPRNRAFSEPEYSAEYSADCSVTLPSDPGQAVGRTHEVTVRSQGCCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDSYIIVMCAVVYTGEKLASVVVASVGLASDIL
LYVLCCYGLLPDRISRRVVPYALWVLIAAQIFCYLGLNYARFHQASDTVGWQAFFSFSFF
LTLPLRLTPIVLITSVSCGVHTLVLGVTIAQQQQEDIQGAALGRQLLANIVIYVCAITVG
VMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKKEA
SQTGQKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAHELVKLLNELFARFDKLAA
KYHQLRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVEAISYVREKTGTDVDMRVGVH
TGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQATMECLHGEFDMEPGNGG
DRCEYLKERGIDSYLVVVPKGPLGKNGINGVKLSVMSSNGNSPLLINTTECNGSVHTACT
TPDDPEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQAL
KGKHTNRLSLRFVDPELETRYSVEKEKQSGAAFSCSCVVLLFTAAMEVLIDPRMIANYVT
LAVGEVLLLVLTVCSLAAIFPRVFPKRLVSFSTWIDHTRWARNTWAMAAIFILTMADIVD
MLSCPRPSGNATMAPPSSVVQSGAEGCLDNPKYYSYIAVLALMATTMLVQVSHMVKVTLM
LLITIATGIVNIYSWRDIFDRYDMARFQDYRSYLVPSKYAMTIMIFIMMISFYYFSRHVE
KLARTLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDE
IGVMFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDESQFRCITKIKTIGSTY
MAASGVTPDVNNGYACLKKEELTDRERWQHLADLADFALAMKVSLMNINYQSFNNFMLRI
GLNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEDCYHILKEYGFRFVR
RGPIFVKGKGELLTYFLKGREKQGSFINGSSVTLPHQVVDNS
NT seq 3369 nt   +upstreamnt  +downstreamnt
atgcctcgcaaccgggccttctcagagccggagtactcagcagagtattcagcggactgc
tctgtgaccctaccatcagacccgggccaggccgtggggcgcacgcacgaggtaacggtt
cgcagccaagggtgctgcctctgcctaccacgcttcatgcgtctcacctttgcacccgag
tctctggagaacctctatcagacctatttccgccggcagcgacacgaaaccctgctggtt
ctggttgtgtttgctgccctgtttgacagctacatcattgtcatgtgcgctgtggtctac
acgggtgaaaagctggcctctgtggtggtggcatcagtgggcctggcatcagacatccta
ctctatgtgttgtgctgctacggcctgctacccgaccgcatctcacgacgtgtggtgccc
tacgccctgtgggtgctcatagcggcccagatcttctgctacctgggcctgaactatgcc
cgcttccaccaggccagtgacacagtgggctggcaggckttctttagcttctccttcttc
ctgacactgcccttgcggctcacgcccattgtgctgatcacatccgtgtcatgcggggtc
cacaccctggtgctgggggtcaccattgcwcagcagcagcaggaggatatccagggggct
gccctcgggagacagctgctggccaacatagtgatctatgtgtgtgcgatcactgtgggc
gtcatgtcctactacatggcagaccggaaacaccgcaaggccttcctggaagcacggcag
tccctggaggtcaaactcaatctggaggaacagagccagcaacaggagcgtctcttgctg
tccatcctgcccaagcatatagcagacgagatgttgcaggacatgaagaagaaagaagcc
agtcagactggacagaaggagatgcagcagttcaacaccatgtacatgtatcgccacgaa
aacgtcagtattttgtttgcagacattgtgggattcactcagctgtcatcatcatgcagt
gcccatgagctggtcaagctcctcaatgaactgtttgcccgctttgacaagctggctgcc
aaataccaccagttgagaataaagatcctgggtgactgttactactgcatctgtggcctg
ccagactacagagaggaccacgctgcctgctccatcatgatgggcctggccatggtggag
gccatttcgtatgttcgtgagaagaccgggacagatgtggacatgcgtgtgggggtacac
actggcactgtcctggggggcgtcctgggacagaagcggtggcagtatgacgtctggtcc
actgacgtcaccgtggccaataagatggaggcgggaggaataccagggcgtgtgcacatc
tcccaggccaccatggagtgtctgcacggggagtttgatatggagccggggaacgggggc
gaccgctgtgagtacctgaaggagaggggcatcgactcctacctggtggtggtgcccaag
ggccccttgggaaagaacggcatcaacggggtgaagttgtctgtgatgtcgtccaatggg
aactctccattgttgatcaacaccactgagtgtaatgggagtgtccacacagcctgcacc
acaccagacgacccagaggagctggacacacgggtggtgaacccttcgttccccaaccct
cggcggaggctaagactgcgggacctggccgagagggtgattgatgcccaagagaacgaa
caggagctcaacaaactgctcaatgaggcactgctggagagagagaccgtacaagctctg
aaggggaaacacaccaatcgtctgtccctgcgctttgtggaccctgagctggagacccgc
tactccgtagaaaaggagaagcagagcggagctgccttcagctgctcctgtgtagtgctc
ctgttcactgcagccatggaagtcctcatagaccctcggatgatagcaaactacgtgacc
ctagctgtgggagaggtcctgctgctcgtcctaactgtctgctctctggcggccatcttc
cctcgagttttccctaagaggctggtgtctttctccacatggatcgaccacacccgctgg
gcacggaacacatgggccatggcagcaatcttcatcctcaccatggccgacattgtggac
atgctgagctgtccccgtccctctggaaacgccacaatggctccaccttcctctgttgtc
caatccggggcagagggctgtctggacaaccccaagtactacagctacatcgccgtgctg
gcactcatggcgaccaccatgctggtacaggtcagccacatggtcaaagtcacactcatg
ctcctcatcaccatagcgacgggcatcgtcaacatctacagctggagggacatatttgac
cgctacgatatggcccgcttccaggactacaggtcttacctggttccctccaaatatgcc
atgactatcatgatcttcatcatgatgatcagcttctactacttttctcgacatgtggag
aagctagcacgtactctgttcttgtggaagattgaggtccatgagcagaaggagaaggtg
tatgagatgaggcgctggaacgaggcgctggtcactaacatgctgccagagcacgtagca
cgccacttcctgggctccaagaaaagggacgaggagctgtacagccagtcatatgatgag
attggggtgatgttcgcctccatccccaacttctcagacttctacacagaggagagcatc
aacaatggggggattgagtgcctcaggttcctcaacgaaataatctccgattttgacagc
ctcctggacgagtctcagttccgctgcatcaccaaaatcaaaaccattggcagcacttac
atggcagcgtcaggagtcactcctgacgtcaacaacggctacgcctgtctgaagaaagag
gagctgactgacagagagcgctggcagcatttggcagatctggctgactttgctctggcc
atgaaggtctcgctcatgaacatcaactaccagtccttcaacaactttatgctacgcata
ggtttgaataaagggggggttctggcaggagtgattggtgcccggaagcctcactatgac
atctggggaaacactgtgaatgtggccagtcgcatggagtccacaggggtcatgggtaac
atccaggtggtggaagattgttaccacatcttgaaggagtacggattccgttttgtgagg
aggggacctatctttgtgaaggggaaaggagagctgcttacctactttctgaagggtaga
gaaaaacagggctccttcatcaacggctcctcggtcaccctgccacaccaagtggtggac
aactcctga

DBGET integrated database retrieval system