KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234673
Entry
112234673         CDS       T05605                                 

Definition
(RefSeq) insulin-like
  KO
K04526  insulin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112234673
   04068 FoxO signaling pathway
    112234673
   04150 mTOR signaling pathway
    112234673
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112234673
  09143 Cell growth and death
   04114 Oocyte meiosis
    112234673
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112234673
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112234673
   04914 Progesterone-mediated oocyte maturation
    112234673
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 112234673
NCBI-ProteinID: XP_024258689
LinkDB
Position
Unknown
AA seq 142 aa
MGGESGVLPQPTFPSAFLLLFYRASSPPPPQPIINMALWLQAASLLVLLALYPGADAAAA
QHLCGSHLVDALYLVCGEKGFFYNPKRDVDPLTGFLFPKSSQENEVAEYPFKDQMDMIVK
RGIVEQCCHKPCNIFDLQNYCN
NT seq 429 nt   +upstreamnt  +downstreamnt
atggggggagaatctggtgttctgcctcaaccaacttttccttcagcatttctgctactc
ttctacagagcttcttcaccaccacctccacagcccatcatcaacatggccctctggctc
caagctgcgtctctgctggtgctgctggccctctatcctggggcagacgctgcagctgcc
caacacctgtgtggctctcatctggtggatgccctctatctggtgtgtggagagaaagga
ttcttttacaacccaaagagagatgtggatcccctaacagggtttctctttccaaaatcg
tcccaggagaacgaagttgccgagtacccgttcaaagaccagatggacatgatagtaaag
agaggtattgtagagcagtgctgtcacaagccttgcaacatcttcgacctgcagaactac
tgcaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234674
Entry
112234674         CDS       T05605                                 

Definition
(RefSeq) insulin-like
  KO
K04526  insulin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112234674
   04068 FoxO signaling pathway
    112234674
   04150 mTOR signaling pathway
    112234674
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112234674
  09143 Cell growth and death
   04114 Oocyte meiosis
    112234674
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112234674
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112234674
   04914 Progesterone-mediated oocyte maturation
    112234674
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 112234674
NCBI-ProteinID: XP_024258690
LinkDB
Position
Unknown
AA seq 142 aa
MGGESGVLPQPTFPSAFLLLFYRASSPPPPQPIINMALWLQAASLLVLLALYPGADAAAA
QHLCGSHLVDALYLVCGEKGFFYNPKRDVDPLTGFLFPKSSQENEVAEYPFKDQMDMIVK
RGIVEQCCHKPCNIFDLQNYCN
NT seq 429 nt   +upstreamnt  +downstreamnt
atggggggagaatctggtgttctgcctcaaccaacttttccttcagcatttctgctactc
ttctacagagcttcttcaccaccacctccacagcccatcatcaacatggccctctggctc
caagctgcgtctctgctggtgctgctggccctctatcctggggcagacgctgcagctgcc
caacacctgtgtggctctcatctggtggatgccctctatctggtgtgtggagagaaagga
ttcttttacaacccaaagagagatgtggatcccctaacagggtttctctttccaaaatcg
tcccaggagaacgaagttgccgagtacccgttcaaagaccagatggacatgatagtaaag
agaggtattgtagagcagtgctgtcacaagccttgcaacatcttcgacctgcagaactac
tgcaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112255913
Entry
112255913         CDS       T05605                                 

Definition
(RefSeq) insulin-like
  KO
K04526  insulin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112255913
   04068 FoxO signaling pathway
    112255913
   04150 mTOR signaling pathway
    112255913
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112255913
  09143 Cell growth and death
   04114 Oocyte meiosis
    112255913
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112255913
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112255913
   04914 Progesterone-mediated oocyte maturation
    112255913
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 112255913
NCBI-ProteinID: XP_024284520
LinkDB
Position
8
AA seq 115 aa
MAVVVWALSVLLLLVLSSPGVCSAPSAQHLCGSHLVDALYLVCGEQGFFYNPHRIPRDLL
LQHLIGFLSRKSRQGWRVKQEHPWKDHEDQKVKRGIVEQCCHKPCSFSHLQSYCD
NT seq 348 nt   +upstreamnt  +downstreamnt
atggctgtggtagtatgggccctgtctgttctgttactgctggtcctgtcttccccgggg
gtctgctcagctcccagcgcccagcacctgtgtggctcacacctggtggatgccctctac
ctggtctgtggggaacaagggttcttctataacccccacagaatccccagagacctactc
ctgcaacaccttatagggttcctgtctaggaagagcagacagggttggagggtgaagcag
gaacatccatggaaggaccacgaagaccagaaggtgaaaagaggcattgtggaacagtgc
tgtcataagccatgtagcttcagccacctgcagagctactgcgactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112259393
Entry
112259393         CDS       T05605                                 

Definition
(RefSeq) insulin
  KO
K04526  insulin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112259393
   04068 FoxO signaling pathway
    112259393
   04150 mTOR signaling pathway
    112259393
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112259393
  09143 Cell growth and death
   04114 Oocyte meiosis
    112259393
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112259393
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112259393
   04914 Progesterone-mediated oocyte maturation
    112259393
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 112259393
NCBI-ProteinID: XP_024289867
LinkDB
Position
9
AA seq 105 aa
MAFWLQAASLLVLLALSPGADAAAAQHLCGSHLVDALYLVCGEKGFFYNPKRDVDPLIGF
FSPKSAKENEEYPFKDQMEMMVKRGIVEQCCHKPCNIFDLQNYCN
NT seq 318 nt   +upstreamnt  +downstreamnt
atggccttctggctccaagctgcatctctgctggtgctgctagcgctctcccccggggca
gacgctgcagctgcccagcacctgtgtggctctcacctagtggacgccctctatctggtg
tgtggagagaaaggattcttttacaacccaaagagagatgtggatccccttatagggttc
ttctctccaaaatcagcaaaggagaacgaagagtaccccttcaaagaccagatggagatg
atggtaaagagaggtattgtagagcagtgctgtcacaagccctgcaacatcttcgacctg
caaaactactgcaactga

DBGET integrated database retrieval system