KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112235626
Entry
112235626         CDS       T05605                                 

Definition
(RefSeq) erythropoietin-like isoform X1
  KO
K05437  erythropoietin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112235626
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112235626
Cytokines and growth factors [BR:otw04052]
 Cytokines
  CSF and other factors
   112235626
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 112235626
NCBI-ProteinID: XP_024259870
LinkDB
Position
Unknown
AA seq 186 aa
MFHNSSRGLFAFLLMLLEWTKPGLSNPLRPICDLRVLKHFIEEARDAEAAMLACKEGHGL
AEPVTVPQTKVDFNVWERKTALEQAQEVQSGLWLLNQAIGSLRTSVTNTALHSHIDNSLR
NIFSIGQVLRSLNIQEYTPPAGGVAGGEETWRVSSASELLQVHVNFLRGKVHLLLSNAPI
CHQGSS
NT seq 561 nt   +upstreamnt  +downstreamnt
atgttccacaattcaagtagaggactctttgcctttctgctgatgctgttggagtggacc
aaaccagggctatctaaccccctgcgtccgatctgtgacctgcgggtcctaaaacacttc
attgaagaggccagagatgctgaggcagccatgctggcatgtaaagaaggacatggtctt
gcagagcccgtcactgttccccaaaccaaagtagacttcaacgtctgggagaggaaaact
gcactggagcaagctcaggaggttcagtctggcctgtggctgttaaaccaggccatcggc
tcgctacgaacgtccgtcaccaacacagcgctgcacagccacatagacaacagcctcaga
aacatcttcagcatcggacaggtgctgcgcagcctcaacatccaggagtacacccctcca
gcagggggcgtggctggaggtgaggagacatggcgggtgtcgtctgcttcagagctcctc
caggtccacgttaacttcctgcgaggcaaggtgcacctcttgctgtccaacgcacccatc
tgccaccagggtagcagctga

DBGET integrated database retrieval system