KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112235685
Entry
112235685         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: inhibitor of apoptosis protein-like
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04120  Ubiquitin mediated proteolysis
otw04210  Apoptosis
otw04217  Necroptosis
otw04510  Focal adhesion
otw04621  NOD-like receptor signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112235685
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112235685
   04217 Necroptosis
    112235685
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112235685
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112235685
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112235685
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112235685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:otw01002]
    112235685
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:otw04121]
    112235685
Peptidases and inhibitors [BR:otw01002]
 Peptidase inhibitors
  Family I32: IAP family
   112235685
Ubiquitin system [BR:otw04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    112235685
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_5 DUF2039
Other DBs
NCBI-GeneID: 112235685
NCBI-ProteinID: XP_024259933
LinkDB
Position
Unknown
AA seq 646 aa
MDTLVQLQNSPFLMGSAGTEPIDLQYDNFSELFRISTFARFPSLGVTERSLARAGWFYTG
VGDRVQCFRCNVTAEGWQTGDCPTERHRQLSSSCSFIQTLPSTANLLSSSHSAFSPLRSA
PVIPVSGPGPAPLPVSAPNPAPNPVPGEEPVGYLNMGFSAPPPSSPLSSRGVEDMSHQRP
PTCHNPSMRREQDRLDSFHSWILSIITPSELAKAGFYYLGQGDRVACFTCGGQLSNWEPG
DRAVSEHQRHYPNCHFVRGDRADNVSLAGVVGGVAGTSQPTGRTPAPRAPAPQVSATCLP
AMQQRRRGCXPRPWPLRIPVRPDQLAKAGYLHVGRNDDVKCFCCDGGLRCWESGDDPWVE
HAKWFPRCVYLLQEKGQEFVHQIQARFPRLFEQLLTNGDSSSREFVDPPGEERSEDAVMM
NTAVVVSSLEMGFERGLVKQTVQSKILTSGENYKTVQELVSDLLSAEDQKREEEREMLAE
EMASDGHSFLKRHQAALVQRLKSVESVLEHLREQNVISGEEYSGLQGQSSQQQTAKLIDL
VLTKGNAAAEVFRNWIQKNDVYLLRDLMAQANEAASPSQDLSDLPMEEQLRRLQEERTCK
VCMDKEVNIVFIPCGHLVVCKECAPSLRKCPICRGLVKGTVRTFLS
NT seq 1941 nt   +upstreamnt  +downstreamnt
atggacaccctggttcagctccagaacagcccgttcctcatgggttctgccggaacggag
cccatagacctgcagtatgacaatttttcagaactgttccgtatctccaccttcgcccgg
tttccgtcattgggggtaacggagcgcagtctggcgagggcaggatggttctatactggg
gttggagacagggtgcagtgtttcaggtgtaacgtgacggcggagggctggcagacaggg
gactgtccaacagagagacacagacagctgtcctcctcctgctccttcatccagaccctc
ccctccacagccaacctcctctcctcctcacactcggccttctctcctctacgcagcgcc
cctgtcataccggtgtcaggccctggcccagcccctctcccggtctccgcccctaaccct
gcccccaacccagtgccgggggaggagcctgttggatatttgaatatggggttctctgcc
ccgcccccctccagcccgctgagctccagaggagtagaggacatgtcccaccagagaccc
cctacctgtcacaaccccagtatgaggagagagcaggaccgtctggactccttccactcc
tggatcctatccatcatcaccccctctgagctggctaaggctggcttctattacctggga
cagggagaccgcgtggcctgcttcacctgtggaggacagctcagtaactgggagccaggg
gaccgggccgtatcagagcaccagagacattaccccaactgtcacttcgtcagaggagac
cgggccgacaacgtctccctagccggggtggtggggggggtagcaggcacctctcagccc
acggggagaaccccagccccccgggccccggccccccaggtctcagcaacgtgtctaccc
gccatgcagcagcgtaggagaggttgctgacctcgtccctggcccttacgtatccctgtg
cgccctgaccagctggccaaggcagggtatctacacgtcgggcgtaatgatgacgtgaag
tgtttctgctgtgacgggggtctgagatgctgggagtcaggtgacgacccctgggtggag
cacgccaaatggttccctaggtgtgtatacctgctccaggagaaaggtcaggagtttgtc
catcagatccaggctcgcttccctcgcctctttgaacagctcctaaccaatggggacagc
agctccagagagtttgtggaccccccgggtgaggagcgctcggaggatgccgtgatgatg
aacactgcggtggttgtgtcgtcactagagatggggtttgagcgtggcctggtgaagcag
acagtccagagtaagattctgaccagcggagagaactacaagacggtccaggaactggtc
tcagacctgctgagtgcagaagatcagaagagagaggaggagagagagatgctggccgag
gagatggcttctgacggtcattcattcttaaagagacaccaggcagcgttggtccagcgc
ctgaagagtgttgagtctgtcctggagcacctccgagagcagaacgtcatcagtggagag
gaatacagtggtctccagggccagtcctcccagcagcagacagccaagctgatagacttg
gtcttgactaaagggaacgcagcagctgaggtcttcaggaactggatccagaagaacgat
gtctacctgctcagagacctcatggcccaggcaaatgaagccgcatcaccgagtcaagat
ctctcagacctgccgatggaggagcagctacggcgcctgcaggaggagcggacctgtaag
gtgtgtatggacaaggaggtgaacattgtcttcatcccgtgtggtcacctggtggtctgt
aaggagtgtgctccctctctgaggaaatgtcccatctgcagaggactggtcaagggcact
gtccgaaccttcctctcctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112236582
Entry
112236582         CDS       T05605                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP-like
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04120  Ubiquitin mediated proteolysis
otw04210  Apoptosis
otw04217  Necroptosis
otw04510  Focal adhesion
otw04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112236582
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112236582
   04217 Necroptosis
    112236582
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112236582
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112236582
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:otw01002]
    112236582
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:otw04121]
    112236582
   03029 Mitochondrial biogenesis [BR:otw03029]
    112236582
Enzymes [BR:otw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     112236582
Peptidases and inhibitors [BR:otw01002]
 Peptidase inhibitors
  Family I32: IAP family
   112236582
Ubiquitin system [BR:otw04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    112236582
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    112236582
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4
Other DBs
NCBI-GeneID: 112236582
NCBI-ProteinID: XP_024260946
LinkDB
Position
Unknown
AA seq 463 aa
MSGPGRDSDLESDHAVDWSMMDMRLDSFRGSPLAQQVSAERLARAGFYFTGQADKVRCFS
CHKTVENWCGGDAPVERHAEVSPSCKFLSCTHRSRVNSLQGAMLTNETSYNEDAEDMEFR
LRTGEVVDDTTYPMAPHMASEDSRFNTFGPWPSTSPVRPRELAQAGLFYLGEGDQVQCFC
CGRMLKGWEAGDTAWGEHSKHYPYCFFILGHDVGNLPSQRGREVEETRPCQGPRVPMQSF
EERLGSFAGIQHHPIDHERLARAGFYSTGAPDHVGCFCCGGGLKGWQQDEDPWEEHAKHY
PGCSFLLAEKGQEFVSSVQLQGPGRNNAASSHLNGCSSHETEVLQSANAQKAVEMGLEPA
LVERTIQERIRRDGTGYSTLETLLQDCFNRDPDSDAENHDEGPLEKLRKLQREKQCKVCM
DRDICIVFIPCGHLVVCKECSEALDKCPICCCAITQKIKTYIS
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtcaggccccgggagagacagtgatctggagtcagaccacgcagtagactggtccatg
atggacatgcggctggactcgttccggggttcccccctggcccagcaggtgtcagcggag
aggctggcccgcgctgggttctacttcacgggacaggccgacaaggtgcgctgcttcagt
tgccacaagactgtagagaactggtgtggaggtgacgcacccgtggagaggcacgcggag
gtctcccccagctgtaagttcctgagctgcacccatcgatccagggttaactctcttcaa
ggtgccatgctgaccaatgaaacctcctacaacgaagacgctgaggacatggagttccgc
ctgaggactggagaggtggtagacgataccacttaccccatggccccgcacatggccagc
gaagactcccggttcaacaccttcggcccgtggccctccacatccccggtccgacctaga
gagctggcccaggcggggctcttctatctgggggagggagaccaggtgcagtgcttctgc
tgtggaaggatgctgaagggctgggaggctggggacacggcgtggggagagcactccaaa
cactacccctactgcttcttcatcctggggcatgatgtggggaacctcccctctcagagg
gggagggaggtggaggagaccaggccatgccagggtcctcgggtccccatgcagagcttt
gaggagaggctaggcagctttgcaggaatccagcaccaccctattgaccacgagaggctg
gccagagcaggcttctacagcacaggtgcaccagaccatgtggggtgtttctgctgtggt
ggaggtctgaagggctggcagcaggatgaggatccctgggaggagcacgccaaacactat
cctgggtgcagttttctactggcagagaaaggacaggagttcgtcagcagcgttcagcta
caaggtcctggccggaacaatgctgcttcaagtcacctaaatggatgttcaagtcatgag
acggaggtgctgcagtcagccaatgcccagaaggcggtggagatgggtctggagcctgcc
ttggtagagaggactatacaggagaggatacgcagggatgggacaggctactccaccctg
gaaactctgctgcaggactgctttaacagagaccctgacagcgacgcagagaaccatgac
gagggtccccttgagaagctacggaagctgcagagggagaaacagtgcaaagtgtgtatg
gacagagacatctgcatcgtcttcattccctgtgggcacctggtcgtctgcaaggagtgt
tccgaggcccttgacaagtgtcccatctgctgttgtgccatcacacaaaagatcaagaca
tacatctcctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112246336
Entry
112246336         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: putative inhibitor of apoptosis
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04120  Ubiquitin mediated proteolysis
otw04210  Apoptosis
otw04217  Necroptosis
otw04510  Focal adhesion
otw04621  NOD-like receptor signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112246336
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112246336
   04217 Necroptosis
    112246336
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112246336
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112246336
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112246336
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112246336
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:otw01002]
    112246336
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:otw04121]
    112246336
Peptidases and inhibitors [BR:otw01002]
 Peptidase inhibitors
  Family I32: IAP family
   112246336
Ubiquitin system [BR:otw04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    112246336
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 DUF2039 zf-C3HC4_2
Other DBs
NCBI-GeneID: 112246336
NCBI-ProteinID: XP_024270411
LinkDB
Position
Unknown
AA seq 617 aa
MDTLVHLQKSPFLIGLCRNGAPVNLQYDNSSELFRISTFALFPTAAVTERTLARAGWFYT
GVGDRVQCFRCNVTAEGXQTGDCPTERHRQLSPSCTFIQSLPSTANLLSSSHSAFSPLCN
AHVIPVSGPGPAPLPVSDPVSCEHPMSHPPLAHWSHQRPPTCHNPSMRREQDRLDSFHSW
ILSIITPSELAKAGFYYLGQGDRVACFTCGGQLSNWEPGDRAVSEHQRHYPNCHFVRGDR
ADNVSMAGGARGVGVLPGLSNVSNPAMQQREERLLTFVHWPLRIPVRPDQLAKAGFYYVG
RNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCHTCPGERSEFVHQIQARXPSALEQPX
TNGDSISREFVDPPMVNLGPGEERSEDAVMMNTPVVVSALEMGFERGLVKQTVQSKILTI
GENYKTVQELVSDLLSAEDQKREEEKEMLTEEMASDGNSFLKRHQAALVLRLKSVESVLE
HLREQNVISGEEYSGLQGQSSQQQTARLIDLVLTKGNAAAEVFRNWIQKNDVYLLRDLMS
QANEASSPSQDSQDLPMEEQLRRLQEERTCKVCMDKEVNIVFIPCGHLVVCKECAPSLRK
CPICRGLVKGTVRTFLS
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggacaccctagtccatctccagaagagcccgttcctcattggtctgtgtcgaaacgga
gccccagttaacctgcagtatgacaactcctcagaactgttccgtatctcgacctttgcc
ctcttcccgactgcagcggtaacagagcgcaccctggccagggcaggatggttctacact
ggtgttggagacagggtgcagtgtttcaggtgtaacgtgacggcggaggganggcagaca
ggtgactgtcctaccgagagacacagacagctgtctccttcttgcaccttcatccagagt
ctaccctctactgccaacctcctctcctcttctcacagcgccttctctccactatgcaac
gcacacgtcataccggtgtcaggacctggcccagcccccctccccgtctctgacccggtg
tcctgtgaacatcccatgtcccacccccctctggcccactggtcccaccagagaccccct
acctgtcacaaccccagtatgaggagagagcaggaccgtctggactccttccactcctgg
atcctatccatcatcaccccctctgagctggcgaaggctggcttctattacctgggacag
ggagaccgcgtggcctgcttcacctgtggaggacagctcagtaactgggagccaggagac
cgggccgtgtcggagcaccagagacattaccccaactgtcacttcgtcagaggagaccgg
gccgacaacgtgtccatggcgggcggggctagaggtgtaggggtgctcccaggtctcagc
aacgtgtctaacccagccatgcagcagcgtgaggagaggttgctgaccttcgtccactgg
cccttacgtatccctgtgcgccctgaccagctggccaaggcagggttctactacgtcggg
cgtaatgatgacgtgaagtgtttctgctgtgacgggggtctgagatgctgggagtcaggt
gacgacccctgggtggagcacgccaaatggttccctaggtgtcatacctgtccaggagaa
aggtcagagtttgtccatcagatccaggctcgcnntccctcggctcttgaacagccctga
accaatggggacagcatctccagggagtttgtggacccaccaatggtgaacctaggtcca
ggtgaggagcggtcagaagatgcagtgatgatgaacactccggtggttgtgtcggctcta
gagatgggatttgagcgaggcctggtcaagcagacggtccagagtaagatcctgaccatc
ggagagaactacaagacggtccaggaactggtctcagacctgctgtctgccgaggaccaa
aagagagaggaggagaaagagatgctgaccgaggagatggcttctgatggtaattcgttc
ttgaagagacaccaggcagcgttggtcctgcgcctgaagagtgttgagtctgtcctggag
cacctccgagagcagaatgtcatcagtggagaggaatacagtggtctccagggccagtcc
tctcagcagcagacagccagactgatagacttggtcttgactaaagggaacgcagcagct
gaggtcttcaggaactggatccagaagaacgatgtctacctgctcagagaccttatgagc
caggcaaatgaagcctcatcaccaagtcaagactctcaagacctgccgatggaggagcag
ctacggcgcctgcaggaggagcggacctgtaaggtgtgtatggacaaggaggtgaacatt
gtcttcatcccgtgtggtcacctggtggtctgtaaggagtgtgctccctctctgaggaaa
tgtcccatctgcagaggactggtcaagggcaccgtccgaaccttcctctcctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112255900
Entry
112255900         CDS       T05605                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP-like isoform X1
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04120  Ubiquitin mediated proteolysis
otw04210  Apoptosis
otw04217  Necroptosis
otw04510  Focal adhesion
otw04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112255900
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112255900
   04217 Necroptosis
    112255900
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112255900
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112255900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:otw01002]
    112255900
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:otw04121]
    112255900
   03029 Mitochondrial biogenesis [BR:otw03029]
    112255900
Enzymes [BR:otw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     112255900
Peptidases and inhibitors [BR:otw01002]
 Peptidase inhibitors
  Family I32: IAP family
   112255900
Ubiquitin system [BR:otw04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    112255900
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    112255900
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4
Other DBs
NCBI-GeneID: 112255900
NCBI-ProteinID: XP_024284504
LinkDB
Position
8
AA seq 467 aa
MSGPGRDSDLESDHAVDWSMMDMRLDSFRGSPLAQQVSAERLARAGFYFTGQADKVRCFS
CHKTVENWCGGDTPAERHAEVSPNCKFLSCTHRSRVNSLQGAMLTNEPHYNEDAEDMEFR
LRTGEVVDESTYPMVPHMVSEDSRFNTLGPWPSTSPVRPRELAQAGLFYLGESDRVQCFC
CGGMLGGWEPGDTAWGEHSKHFPYCFFILGHDVGNLPSQAGREEEVGETRPRPGPRVPMQ
SFEERLGSFAGIQHPIDHERLARAGFYNTGAPDRVVCFCCGGGLKGWQPDENPWEEHAKH
YPGCNFLLTEKGQEFVSSVQLQGPGRNNAASSHLNGCSSHGTEVLRSAMAQRAVEMGLEP
ALVERTILERIRRAGTGYSTLETLLQDCFNRGPDSDAETAENHDEDPFEKLRKLQREKQC
KVCMDRDICIVFIPCGHLVVCKECSEALDKCPICCAAITQKIKTYIS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcaggccccgggagagacagtgatctggagtcggaccacgcagtagactggtccatg
atggacatgcggctggactcgttccggggttcccccctggcccagcaggtgtcagcggag
aggctggcccgtgctgggttttacttcacaggacaggctgacaaggtgcgctgcttcagc
tgccacaaaactgtagagaactggtgtggaggggacacacctgcggagaggcacgcggag
gtctcccctaactgtaagttcctgagctgcacccatcgttccagggtcaactctcttcaa
ggtgccatgctgaccaacgaaccccactacaacgaagacgctgaggacatggagttccgc
ctgagaacgggagaggtggtggatgagtccacctaccccatggtcccgcacatggtcagc
gaagactcccggttcaacaccttaggcccgtggccctccacatccccggtccggcctaga
gagctggcccaggcagggctcttctatctgggggagagtgaccgggtgcagtgcttctgc
tgtggagggatgctggggggctgggagcctggggacacagcgtggggggagcactccaaa
cacttcccctactgcttcttcatactggggcatgatgtggggaacctcccctctcaggcg
gggagagaggaggaggtaggggagaccaggccacgcccgggtcctcgggtccccatgcag
agctttgaggagaggctaggcagctttgcaggaatccagcaccctattgaccacgagagg
ctggccagagcaggcttctacaacacaggagctccagaccgtgtggtgtgtttctgctgt
ggtggaggtctgaagggctggcagccggacgagaatccctgggaggagcatgccaaacac
tatccggggtgtaattttctgctgacagagaaaggacaggagttcgtcagcagtgttcag
ttacaaggtcctggcaggaacaatgctgcttcaagtcacctgaatggatgttcaagtcac
ggaacagaggtgctgaggtcagccatggcccagagggcggtagagatgggtctggagcct
gccctggtagagaggaccatactggagaggatacgcagggctgggacaggctactccacc
ctggagactctgctgcaggactgctttaacagaggccctgacagcgacgcagagaccgca
gagaaccatgatgaggatccctttgagaagctacggaagctgcagagggagaaacagtgc
aaagtgtgtatggacagagacatctgcatcgtcttcatcccctgtgggcacctggtcgtc
tgcaaggagtgttccgaggccctcgacaagtgtcccatctgctgtgcagccatcacacaa
aagatcaagacatacatctcctaa

DBGET integrated database retrieval system