KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112235777
Entry
112235777         CDS       T05605                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04144  Endocytosis
otw04218  Cellular senescence
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04371  Apelin signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112235777
   04350 TGF-beta signaling pathway
    112235777
   04371 Apelin signaling pathway
    112235777
   04068 FoxO signaling pathway
    112235777
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112235777
  09143 Cell growth and death
   04110 Cell cycle
    112235777
   04218 Cellular senescence
    112235777
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112235777
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 112235777
NCBI-ProteinID: XP_024260070
LinkDB
Position
Unknown
AA seq 425 aa
MSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNIN
TKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLQSHHELRAVELCEYAFHTKKDEVC
VNPYHYQRVETPVLPPVLVPRHTEIPSEFPPLDDYSHSIPENTNFPAGIEPQSNYIPETP
PPGYLSEDGETSDHLMNHSMDTSSPNLSPNPVSPTHSNLDLQPVMYCEPAFWCSISYYEL
NQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAELLAQSVNHGF
EAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIELHLNGPLQWLDKVLMQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcaattctgccttttactccccccattgtgaaaaggcttttgggttggaaaaaaggc
gaacagaacggacaagaggagaaatggtgtgaaaaagctgtgaaaagcctggtgaagaag
ttgaagaaaacagggcaactggatgaattggaaaaagccatcacgacacagaatatcaac
acgaaatgtattactataccaaggtctctggatggacggttacaggtgtcccacaggaag
ggcctcccgcacgtcatctactgtcgcctgtggcgctggccggacctgcagtcccaccac
gagctgcgggccgtggagctctgtgagtacgccttccacaccaagaaggatgaggtgtgt
gtcaacccctaccactaccagagggtggagacgccagtgctgcctcctgtgctggttccc
agacacacagagatccccagtgagtttcctcctctggacgactacagccactccatccca
gagaacaccaacttccccgccggcatcgagccacagagcaactacataccagagactcct
ccacctggctatctcagtgaagatggggagaccagtgatcacctgatgaaccacagcatg
gacaccagttcacccaacctgtcaccaaacccagtgtctccaacacacagcaatttagac
ctacagcctgtgatgtactgtgaaccagccttctggtgttctatctcctactacgagctg
aaccagcgggtgggcgagaccttccacgcctcccagccgtccctcactgtggacggcttc
accgacccctccaactcagagcgcttctgcctgggcctcctctccaacgtcaaccgtaac
gccgctgtggagctgacacgcagacacatcggcagaggggtacgtttgtactatattgga
ggagaggtgtttgcagagtgcctcagcgacagtgccatcttcgtccagagtcccaactgt
aaccagcgttacggctggcaccccgccacggtctgcaagatccccccaggctgcaacctg
aagatctttaacaaccaggagtttgctgagctgctggcccagtccgtcaaccacgggttt
gaggctgtctacgagctgaccaagatgtgcaccatccgcatgagcttcgtcaagggctgg
ggtgcagagtaccaccgccaagacgtgaccagcaccccttgttggatcgagctgcacctc
aacggtcccctgcagtggctggacaaggtgctcatgcaaatgggttcccccagcatccgc
tgctccagcgtgtcgtag

DBGET integrated database retrieval system