KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112235861
Entry
112235861         CDS       T05605                                 

Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04218  Cellular senescence
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04623  Cytosolic DNA-sensing pathway
otw04625  C-type lectin receptor signaling pathway
otw04672  Intestinal immune network for IgA production
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112235861
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112235861
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112235861
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112235861
   04621 NOD-like receptor signaling pathway
    112235861
   04623 Cytosolic DNA-sensing pathway
    112235861
   04625 C-type lectin receptor signaling pathway
    112235861
   04672 Intestinal immune network for IgA production
    112235861
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112235861
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112235861
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112235861
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Interleukins
   112235861
SSDB
Motif
Pfam: IL6 IL23
Other DBs
NCBI-GeneID: 112235861
NCBI-ProteinID: XP_024260179
LinkDB
Position
Unknown
AA seq 219 aa
MNSSTSYLSLLSALVVLVKGNPVPSALSELMTSGWTSGEELGTDGETGAPPKWEKMIKML
VHEVTTLRNQQFVEEFQKPVEEISSFSQHQVPYTPPHLSKTLCSTSNKEACLQEISRGLQ
VYQLLLQHVKAEYPQSTLLPSVTHQTTVLIGLVKDQMKVAEVVEDLSASERKRVLGEVST
GTEWERKTSVHAILRELRNFLVDTKRALRRMAKRGKDFQ
NT seq 660 nt   +upstreamnt  +downstreamnt
atgaattcttctacaagctatctctcactcctctcggcgctcgtggtgttagttaagggg
aatccagtgcccagcgcgctctctgagctcatgacctccggatggacctcaggagaggag
ctcgggacagacggtgaaacgggcgcgcccccgaagtgggagaaaatgatcaagatgctc
gttcacgaggtaaccaccttgcggaaccaacagtttgtggaggagtttcagaagcccgtg
gaagagatttcatcgttctcacagcaccaggtcccatacaccccaccacacctctccaag
actctttgctccacctccaacaaggaggcatgtctgcaggagatcagtcggggtctgcaa
gtgtaccagcttcttcttcagcatgttaaggctgaataccctcaatcaaccctactcccc
tctgtcacacaccagaccactgtcctgatagggctggtcaaagaccagatgaaggttgct
gaggtagtagaggacctgtctgccagtgagaggaagcgtgttctgggtgaggtgtctacg
gggacagagtgggagaggaagaccagcgttcacgccatccttagggagctacgtaacttc
ctggttgacaccaagagagccctccgccgcatggcaaagaggggcaaagacttccagtaa

DBGET integrated database retrieval system